KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5284Help
Entry
Bcen2424_5284     CDS       T00415                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcen2424_5284
Enzymes [BR:bch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     Bcen2424_5284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2363649..2364713
Genome map
AA seq 354 aa AA seqDB search
MFTSISSHSSFPAERVKLCARPRRMIRQPHIGRDDPMNDHTHFQPLGGNEMPRCGGIATM
MRLPHVSSAEGLDACFVGVPFDLGTSNRTGARFGPRQIRTESVLLRPYNMATRAAPFDSL
QIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKPITLGGDHTIALPILRAIHRKHGKV
ALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLHGDKVTQIGLRGTGYAAEDFDWCRE
QGFRVVQAEECWNKSLAPLMEEVRARIGDTPVYITFDIDGIDPAYAPGTGTPEIAGLTVP
QALEIIRGAMGLNIVGCDLVEVAPPYDPFGTTALLGANLAYELLCVLPGVAYRD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtttacgtcgatatcttcgcattcttctttcccggcggagcgcgtaaaactgtgcgcc
aggccgcgtcgcatgatacggcaaccccacatcggaagagacgaccccatgaacgaccac
acccatttccagccgctcggcggcaatgaaatgccgcgctgcggcggcatcgcgacgatg
atgcgcctgccgcacgtgtcgagcgccgaaggcctcgacgcgtgtttcgtcggcgtgccg
ttcgatctcggcacctccaaccgcaccggcgcgcgcttcggcccgcgccagatccgtacc
gaatccgtgctgctgcgcccgtacaacatggccacgcgcgcagcacccttcgattcgctg
cagatcgccgacatcggcgacgtcgcgatcaatccgtacaacctgcacgattcgatcgcc
cgcatcgaggccgcgtacgacgcgattctcgagcacgactgcaagccgatcacgctcggc
ggcgaccatacgatcgcgctgccgatcctgcgcgcgatccaccgcaagcacggcaaggtt
gcattgatccacgtcgatgcacacgccgacgtgaacgacacgatgatgggcgaaaagatc
gcgcacggcacgccgttccgccgcgcggtcgaggaagggctgctgcacggcgacaaggtc
acgcagatcggcctgcgcggcaccggctacgcggccgaggatttcgactggtgccgcgag
cagggcttccgcgtggtccaggccgaggaatgctggaacaagtcgctcgcgccgctgatg
gaagaagtgcgcgctcgcatcggcgacacgcccgtctacatcacgttcgacatcgacggc
atcgatccggcctatgcgccgggcaccggcacgccggaaatcgcgggcctcacggtgccg
caggcgctcgagatcatccgcggcgcgatggggctgaacatcgtcggctgcgatctcgtc
gaagtcgcgccgccgtacgacccgttcggcaccacggcgctgctcggcgcgaacctcgcg
tacgagctgctgtgcgtgctgccgggcgtcgcgtaccgcgactga

DBGET integrated database retrieval system