KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5375Help
Entry
Bcen2424_5375     CDS       T00415                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcen2424_5375
Enzymes [BR:bch01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Bcen2424_5375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2472538..2472927)
Genome map
AA seq 129 aa AA seqDB search
MTTDVLAVALRFFSLWTENRIDDALSMLSDDVLYDNVPFPDIVGRDNVRQFHGDFGIGTT
FKVDWTVTHIAAAGNVVLNERIDVFQHESGGKITLPVMGTLTIVDDRITVWRDYFDPADF
DRQLSAIKK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgatgttttggccgtggcgcttcgattcttttcgctttggaccgaaaaccgc
atcgacgacgcgctgtcgatgctctccgatgatgtcctctacgacaacgttccgttcccc
gacatcgttggacgggacaatgttcgccaattccacggcgacttcgggatcggtacgacg
ttcaaggtcgactggacggtgacccatatcgccgcagcgggaaacgtcgtcctcaatgag
cggatcgacgtctttcaacacgaatcaggcggaaaaatcacgcttcccgtgatgggtacc
ctgaccatcgtcgatgatcgaatcacggtttggcgagactacttcgatcccgcggacttc
gatcggcagttgagtgcaatcaagaagtag

DBGET integrated database retrieval system