KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5614Help
Entry
Bcen2424_5614     CDS       T00415                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Bcen2424_5614
Enzymes [BR:bch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Bcen2424_5614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2726333..2727115)
Genome map
AA seq 260 aa AA seqDB search
MAETLNLTKEALVALAERRLENEVGDSGWSARQKLALTCRILFDAGHDSGLAGQITCRAD
AAGTYYTQRLGLGFDEILAANLLRVNEDLDVVDGDGIPNPANRFHTWIYRERPDVNCIIH
THPAHVAALSMLEQPLVVSHMDTCPLYDDCAFLKDWPGVPVGNEEGEIISKALGSKRAIL
LSHHGQLVVGKTIEEACILALLIERAAKLQLLAMSAGEIKPVPPALAREAHDWISKPKRD
AVTFDYYARRALHTHQDCVA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgctgaatttgacgaaggaagcgctggtcgcgctggcagagcggcgtctg
gaaaacgaggtgggggacagcggctggtccgcgcgacaaaagcttgcgctgacctgccgg
attttgttcgacgccggccacgactcgggcctggccgggcagatcacctgccgcgcggac
gcggccggcacgtactacacgcagcggctcgggctcggcttcgacgagatcttggccgcg
aacctgctgcgcgtcaacgaggatctcgacgtcgtcgacggcgatggcattccgaacccg
gccaaccggttccatacgtggatttatcgcgaacgcccggacgtgaactgcatcatccat
acgcatcccgcgcatgtcgcggcgctgtcgatgctcgaacagccgctcgtcgtgtcgcat
atggatacctgcccgctgtacgacgattgtgcgttcctgaaggactggccgggcgtgccg
gtcggcaacgaggagggcgagatcatctcgaaggcgctcggcagcaagcgcgcgattctg
ctgtcgcatcacggtcagctcgtggtcggcaagacgatcgaggaggcgtgcattctcgcg
ctgttgatcgaacgcgccgcgaagcttcaactgctcgcgatgtcggccggcgagatcaaa
ccggtgcctccggcgttggcgcgtgaggcgcacgactggatctcgaagcccaagcgcgat
gcggtgacgttcgactactacgcgcgccgcgcattgcatacgcatcaggattgcgtcgcg
taa

DBGET integrated database retrieval system