KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5669Help
Entry
Bcen2424_5669     CDS       T00415                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcen2424_5669
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen2424_5669
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen2424_5669
Enzymes [BR:bch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcen2424_5669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2786217..2788391
Genome map
AA seq 724 aa AA seqDB search
MIDQAGLQVAPALSQFIENEALPGTGIDKAAFWSGFSALVHDLAPRNRELLAERDRLQQE
LDAWHRAHPGPVRDHAAYRAFLEKIGYLVPVPSNVAAATANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGAERTAAYNPTRGQRVIDYARNVLDNAAPLA
SGSHRDALRYRVQDGQLAVETAQGVVHLAQPAQFVGYQGAADAPSAILLKHNGLHLEIQI
DASTPIGRADLANVKDVVLEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMQGTLVEEV
AKGGKTFTRRLNADREYTTPAGGTLSLHGRSLLFVRNVGHLMTNGAVLDRDGNEIPEGIL
DGVVTTLCALHDLKAKRNSRTGSIYIVKPKMHGPVEVAFADTLFARIEDLYNLPRNTLKM
GIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKSSAWI
QSYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELEKTPYASERDALLEGLLTVPVVERAAWSEAEILSEVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPGYDQSTAFKAACALALQGTSQPSGYTEPLLHRFRLAFKAQ
QHGA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccaagcaggactgcaagtcgcgccagcgctaagccagttcattgaaaacgaa
gcgctgccgggcaccggcatcgacaaggccgcgttctggagcggtttctcggcgctggtg
cacgacctcgcgccgcgcaaccgcgagctgctcgccgaacgcgaccgcctgcagcaggaa
ctcgacgcgtggcatcgcgcgcaccccggcccggtacgcgaccatgccgcgtatcgcgcg
ttcctcgaaaaaatcggctacctcgtgccggtcccgtcgaacgtcgcggcagccaccgcg
aacgtcgacagcgagatcgccacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcacgctatgcgctgaacgccgcgaacgcacgctggggcagcctgtacgacgcgctgtac
ggcaccgacgcgctgccggaagacggcggcgccgaacgcaccgcggcctacaacccgacg
cgcggccagcgcgtgatcgactacgcgcgcaatgtgctcgacaacgcggcgccgctcgcg
agcggctcgcaccgcgacgcgctgcgctaccgcgtgcaggacggccagctcgcggtcgaa
accgcgcagggcgtcgtgcacctcgcgcagccggcgcagttcgtcggctatcaaggcgcg
gccgatgcgccgtccgcgatcctgctgaagcacaacggcctgcacctcgagatccagatc
gatgcgtcgaccccgatcggccgcgccgatctcgcgaacgtgaaggacgtcgtgctcgaa
gccgcggtcagcacgatcatcgactgcgaggattcggtcgcggcggtcgacgccgacgac
aaggtccagctctaccgcaactggctcggcctgatgcagggcacgctggtcgaggaagtc
gcgaagggcggcaagaccttcacgcgccgcctgaacgccgatcgcgagtacacgacgccg
gccggcggcacgctgtcgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccac
ctgatgaccaacggcgcggtgctcgaccgcgacggtaacgaaattccggaagggattctc
gatggcgtcgtcacgacgctgtgcgcgctgcacgacctgaaggccaagcgcaactcgcgc
acgggctcgatctacatcgtgaagccgaagatgcacgggccggtcgaagtcgcgttcgcc
gacacgctgttcgcgcgcatcgaagatctgtacaacctgccgcgcaacacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcgtgtatcgcggcagcg
gccgcgcgcgtcgcgttcatcaacaccggcttcctcgaccgcaccggcgacgagatgcat
accgcgatggaagcgggcccgatgatccgcaagggcgacatgaagtcgtcggcgtggatc
cagtcgtacgagcgcaacaacgtgctcgcgggcctgtcggccggcctgcgcggccgcgcg
cagatcggcaagggcatgtgggcgatgccggacctgatgcatgcgatgctcgagcagaag
atcgcgcatccgcgcgccggcgcgaacaccgcctgggtgccgtcgccgaccgccgcgacg
ctgcacgcgctgcactaccacctcgtcgacgtgcaggccgtccagcaggaactcgagaag
acaccgtacgcgagcgagcgcgacgcgctgctcgaagggctgctgaccgtgccggtcgtc
gagcgtgccgcgtggagcgaggccgagatcctgagcgaggtcgagaacaacgcgcagggc
atcctcggctacgtcgtgcgctgggtcgaacagggcgtcggctgctcgaaggtgccggac
atccacgacgtcggcctgatggaagatcgcgcgacgctgcgcatttcgagccagcacatc
gcgaactggctgcgccacggcgtgatcaccgaggcgttcgtgctcgacgtgttcaagcgg
atggcccgcgtcgtcgaccagcagaacgccggcgatccgaactatcgcccgatggcgccc
ggctacgaccagtcgaccgcgttcaaggccgcgtgcgcgctcgcgctgcaaggcacgtcg
cagccgagcggctataccgagccgctgctgcatcggttccggctcgcgttcaaggcgcag
cagcacggcgcataa

DBGET integrated database retrieval system