KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5669Help
Entry
Bcen2424_5669     CDS       T00415                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcen2424_5669
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen2424_5669
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen2424_5669
Enzymes [BR:bch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcen2424_5669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2786217..2788391
Genome map
AA seq 724 aa AA seqDB search
MIDQAGLQVAPALSQFIENEALPGTGIDKAAFWSGFSALVHDLAPRNRELLAERDRLQQE
LDAWHRAHPGPVRDHAAYRAFLEKIGYLVPVPSNVAAATANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGAERTAAYNPTRGQRVIDYARNVLDNAAPLA
SGSHRDALRYRVQDGQLAVETAQGVVHLAQPAQFVGYQGAADAPSAILLKHNGLHLEIQI
DASTPIGRADLANVKDVVLEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMQGTLVEEV
AKGGKTFTRRLNADREYTTPAGGTLSLHGRSLLFVRNVGHLMTNGAVLDRDGNEIPEGIL
DGVVTTLCALHDLKAKRNSRTGSIYIVKPKMHGPVEVAFADTLFARIEDLYNLPRNTLKM
GIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKSSAWI
QSYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELEKTPYASERDALLEGLLTVPVVERAAWSEAEILSEVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPGYDQSTAFKAACALALQGTSQPSGYTEPLLHRFRLAFKAQ
QHGA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccaagcaggactgcaagtcgcgccagcgctaagccagttcattgaaaacgaa
gcgctgccgggcaccggcatcgacaaggccgcgttctggagcggtttctcggcgctggtg
cacgacctcgcgccgcgcaaccgcgagctgctcgccgaacgcgaccgcctgcagcaggaa
ctcgacgcgtggcatcgcgcgcaccccggcccggtacgcgaccatgccgcgtatcgcgcg
ttcctcgaaaaaatcggctacctcgtgccggtcccgtcgaacgtcgcggcagccaccgcg
aacgtcgacagcgagatcgccacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcacgctatgcgctgaacgccgcgaacgcacgctggggcagcctgtacgacgcgctgtac
ggcaccgacgcgctgccggaagacggcggcgccgaacgcaccgcggcctacaacccgacg
cgcggccagcgcgtgatcgactacgcgcgcaatgtgctcgacaacgcggcgccgctcgcg
agcggctcgcaccgcgacgcgctgcgctaccgcgtgcaggacggccagctcgcggtcgaa
accgcgcagggcgtcgtgcacctcgcgcagccggcgcagttcgtcggctatcaaggcgcg
gccgatgcgccgtccgcgatcctgctgaagcacaacggcctgcacctcgagatccagatc
gatgcgtcgaccccgatcggccgcgccgatctcgcgaacgtgaaggacgtcgtgctcgaa
gccgcggtcagcacgatcatcgactgcgaggattcggtcgcggcggtcgacgccgacgac
aaggtccagctctaccgcaactggctcggcctgatgcagggcacgctggtcgaggaagtc
gcgaagggcggcaagaccttcacgcgccgcctgaacgccgatcgcgagtacacgacgccg
gccggcggcacgctgtcgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccac
ctgatgaccaacggcgcggtgctcgaccgcgacggtaacgaaattccggaagggattctc
gatggcgtcgtcacgacgctgtgcgcgctgcacgacctgaaggccaagcgcaactcgcgc
acgggctcgatctacatcgtgaagccgaagatgcacgggccggtcgaagtcgcgttcgcc
gacacgctgttcgcgcgcatcgaagatctgtacaacctgccgcgcaacacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcgtgtatcgcggcagcg
gccgcgcgcgtcgcgttcatcaacaccggcttcctcgaccgcaccggcgacgagatgcat
accgcgatggaagcgggcccgatgatccgcaagggcgacatgaagtcgtcggcgtggatc
cagtcgtacgagcgcaacaacgtgctcgcgggcctgtcggccggcctgcgcggccgcgcg
cagatcggcaagggcatgtgggcgatgccggacctgatgcatgcgatgctcgagcagaag
atcgcgcatccgcgcgccggcgcgaacaccgcctgggtgccgtcgccgaccgccgcgacg
ctgcacgcgctgcactaccacctcgtcgacgtgcaggccgtccagcaggaactcgagaag
acaccgtacgcgagcgagcgcgacgcgctgctcgaagggctgctgaccgtgccggtcgtc
gagcgtgccgcgtggagcgaggccgagatcctgagcgaggtcgagaacaacgcgcagggc
atcctcggctacgtcgtgcgctgggtcgaacagggcgtcggctgctcgaaggtgccggac
atccacgacgtcggcctgatggaagatcgcgcgacgctgcgcatttcgagccagcacatc
gcgaactggctgcgccacggcgtgatcaccgaggcgttcgtgctcgacgtgttcaagcgg
atggcccgcgtcgtcgaccagcagaacgccggcgatccgaactatcgcccgatggcgccc
ggctacgaccagtcgaccgcgttcaaggccgcgtgcgcgctcgcgctgcaaggcacgtcg
cagccgagcggctataccgagccgctgctgcatcggttccggctcgcgttcaaggcgcag
cagcacggcgcataa

DBGET integrated database retrieval system