KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5775Help
Entry
Bcen2424_5775     CDS       T00415                                 

Definition
glyoxalase/bleomycin resistance protein/dioxygenase
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2896402..2897472
Genome map
AA seq 356 aa AA seqDB search
MKLTTAQPARSPQPTTKARALSYLMFERPDLERAERFLNDFGLRTVSRDGDHLFLRGTAA
TPFCYVVRRAEKNRFVGFGLEVDGIDALRKLADVPGASDVEPSPWPGGGHRVTLVDPSGF
RVDAVAGQARAGALPHRSALPFNSPDSIVRVNDTQRPPLEVPEVIRLGHVVLELADFQAT
CAWYTSHFGFIPSDVQVLPDGSPAVAFLRLDRGATPADHHTLALAQGFAALYSHSAFELV
DADAVGVGQRVLSERGWTHAWGMGRHILGSQVFDYWQDPWGDKHEHYCDGDMFTADVATG
IHEVSREAMSQWGPRMPRSFTKPKITAASIASLIRNLRTSPDVTFAKLRTLAKLFA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcactactgcacaacccgcacggagtccccagccgacgacgaaggcccgggcg
ctttcctatctgatgttcgagcgtcccgatctcgagcgggccgaacgatttctcaacgat
ttcggcctgcggacggtatcccgtgacggcgaccatctgttccttcggggcacggccgcg
acaccgttctgctacgtcgtccggcgggctgaaaaaaaccgcttcgtcggcttcgggctc
gaagtcgacggcatcgacgcactgcgcaagcttgccgacgtgccgggcgcgtcggacgtg
gagccgtcgccgtggcccggtggcgggcatcgcgtcacgctcgtcgatccgtcgggtttt
cgtgtcgacgcagtcgcgggacaagcgcgggccggcgccctgccgcaccggtcggcgtta
ccgttcaactcgcccgattccatcgttcgcgtgaacgatacccagcgtccgccgctggaa
gtgccggaagtgattcgcctcggtcatgtcgtgctcgaactcgccgatttccaggcgacc
tgcgcgtggtacacgtctcacttcggcttcatcccgagcgacgttcaggtgttgccggac
ggctcgcccgccgtcgcgttcctgcgactcgatcgcggggcgacacccgccgatcaccat
accctggcattggcacaggggttcgcagcgctgtacagccactcggcattcgagctggtt
gacgcggatgccgtgggggtcgggcagcgtgtgctgagcgaaagaggatggacgcacgca
tggggaatggggcgccacattctcggcagccaggtcttcgactattggcaggacccttgg
ggcgacaagcacgaacactattgcgatggggacatgttcacggcggacgtggcgacgggt
atccacgaagtcagccgtgaagcgatgtcgcaatggggcccccggatgccgcgcagcttc
accaaaccgaagatcaccgcggcgagcatcgcatcgctcatccgaaacctccggaccagt
ccggacgtcacgttcgcgaagctgcgcacgctcgcgaagctgtttgcgtga

DBGET integrated database retrieval system