KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5791Help
Entry
Bcen2424_5791     CDS       T00415                                 

Definition
esterase/lipase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bch  Burkholderia cenocepacia HI2424
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2915219..2916034
Genome map
AA seq 271 aa AA seqDB search
MTGRTAVLLIHGLGGTQYDLGSLHKAMRRAGADTHMITLPGHGTRPEDLVGVRAEAWLDA
VTEQYRALEREYDTLHVAGMCMGALVALLLCHRVQHARGRLALLAAPVFIDGWSTPWYRS
LRHVLYRVPGVAERMRVEEGDPFGIKNATIRAIVKKKFERQDSFHYAWVPLACVRQVDRM
RDWVRDAAPGTPCPTLVLHAREDELTSLRSADFLLEKLPDARGIVLENSYHMICADNDRD
DVARHVLEFFGFDPVHAVSPAMARRMGRLGS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacgggccgcacggccgtgctgctgatccacgggctcggcggcacgcaatacgatctc
ggttcgctgcacaaggcgatgcggcgcgcgggcgccgacacgcacatgatcacgctgccg
gggcacggcacgcgcccggaggatctggtcggcgtgcgcgcggaggcgtggctcgacgcg
gtgaccgagcagtaccgcgcgctggaacgcgagtacgacacgctgcacgttgcggggatg
tgtatgggcgcgctcgtcgcgctgctgctgtgtcatcgtgtgcagcatgcgcgcggccgg
ctcgcgctgttggccgcaccggtattcatcgacggctggtcgacgccgtggtaccggtcg
ctgcggcacgtgctgtatcgcgtgccgggtgtggcggagcgaatgcgcgtggaagaaggc
gatccgttcggcatcaagaacgcgacgatccgcgcgatcgtgaagaagaagttcgagcgg
caggacagtttccactatgcgtgggtgccgctcgcgtgcgtgcggcaggtggaccggatg
cgcgactgggtacgcgatgccgcgcccggcacgccgtgcccgacgctcgtgctgcatgcg
cgcgaggacgagctgacgagcctgcgctcggccgatttcctgctggaaaagctgcccgac
gcgcgcgggatcgtgctggagaacagctatcacatgatctgcgcggacaacgatcgcgac
gacgtcgcgcggcacgtgctcgagttcttcggcttcgatcccgtgcatgcggtgagcccg
gcgatggcgcggcggatggggcggctgggatcgtga

DBGET integrated database retrieval system