KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6126Help
Entry
Bcen2424_6126     CDS       T00415                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcen2424_6126
Enzymes [BR:bch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcen2424_6126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(283187..284113)
Genome map
AA seq 308 aa AA seqDB search
MSELTSPRIAVVGSVNIDLVTRAPRLPVPGETLLGTTFETVHGGKGANQAVAAARLGASV
AMIGCVGDDAFGARLHAALAAERIDVTHLHRIAGTATGVATITVDDGGANSIVVVPGANA
CVDADRIDAARDAIAGAALLVCQLEVPVASVARAIACASAHHTPVLLNPAPAQPLFDALL
ARVDYLVVNETEAESLTGIAVGDDASAARAADALCAKGVGNVLVTLGARGVCWRGSAGRG
RHRAMAVAAVDTTAAGDTFVGGFAVARAGGASMDDAIGFGQRAAAISVTRHGAQTSIPTR
DEVNPMDT
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctcacctcaccgcgtatcgctgtcgtcggcagcgtcaacattgacctcgtc
acacgggcgccgcgcctgccggtgccgggcgaaacgctgctcggcacgacgttcgagacc
gttcacggcggcaagggcgcgaaccaggcggtcgcggccgcgcgcctcggtgcatcggtc
gcgatgatcggctgtgtcggcgacgacgcgttcggcgcgcgcctgcacgccgcgctggcg
gcggagcgcatcgacgtgacgcacctgcaccggatcgcgggcacggcaaccggcgtggcc
acgatcacggtcgatgacggcggcgcgaacagcatcgtcgtcgtgcccggcgcgaatgca
tgcgtcgatgccgaccggatcgacgcggcgcgcgacgcgatcgccggagccgcgctgctc
gtgtgccagctcgaagtgccggtcgccagcgtggcgcgtgcgattgcctgcgcaagcgcg
caccacacgccggtgctgctcaacccggcgcccgcgcaaccgcttttcgatgcgctgctg
gcgcgggtcgactatctcgtcgtcaacgaaaccgaggccgagtcgctgaccggcatcgcc
gtgggcgacgacgcatcggccgcgcgcgccgccgatgcgctgtgcgcgaagggcgtcggc
aacgtgctggtcacgctcggcgcgcgcggcgtgtgctggcgcggcagcgcagggcgcggc
cgccatcgtgcgatggcggtggcggccgtcgatacgaccgcggccggcgacacgttcgtc
ggcgggttcgcggtcgcgcgggccggcggcgcgtcgatggacgacgcgatcggcttcggc
cagcgtgcggcggcgatcagcgtcacgcgtcatggcgcgcagacgtcgattccgacgcgc
gatgaagtcaaccctatggatacctga

DBGET integrated database retrieval system