KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6193Help
Entry
Bcen2424_6193     CDS       T00415                                 

Definition
cobyrinic acid a,c-diamide synthase
Orthology
K03496  
chromosome partitioning protein
Organism
bch  Burkholderia cenocepacia HI2424
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:354911..355606
Genome map
AA seq 231 aa AA seqDB search
MAFKIAVSNQKGGTGKTTISVNIAAAFEAGGNKVALIDADPQGTSVRWVTSGENTLPMTV
LSLAPAGRGIGGEIKKQDANFDVIVVDCPGNLEDPRIASVLEVADFCLVPLSPSPADLYS
TVAMIRMIESMRAVRNPQLSSALMLNSVNGKTKMREEILKILRAEEIGEHLLDSQIAQRE
VYRQTFALGTTIHHHNRYLKGLKEARAEIEKLVTEMAQYIASTRATGAAHG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaagatcgccgtcagtaatcaaaaaggtgggacgggaaagacgaccatctcc
gtcaacatcgcggctgcgttcgaagccggcggcaacaaagtcgcgttgatcgatgccgac
cctcagggcacttccgtccgttgggtcacgagcggcgagaacacgctgccgatgacggtc
ctttcgctggctcccgccggccgcggcatcgggggcgagatcaagaagcaggacgcgaac
tttgatgtgatcgtcgtcgactgccccggcaacctcgaagatccgcgtatcgcatccgtc
ctggaagtggccgacttctgcctggtgccgctttcgccatcgccggccgatctgtacagc
acggtcgcgatgatccgcatgatcgaatcgatgcgcgccgttcgaaatcctcaactttct
tccgcattaatgctgaatagcgtcaatggaaaaactaaaatgcgtgaagaaattttaaaa
attctacgggctgaagaaataggggagcatctgctcgacagccagatcgcgcaacgcgag
gtctatcgtcagacgttcgcgctcggcaccacgatccatcaccacaatcgatacctgaag
ggcctgaaggaagcccgcgcggaaatcgaaaagctggtcacggaaatggcccaatacatc
gcgtcgacgcgcgctaccggagccgcccatggctaa

DBGET integrated database retrieval system