KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6193Help
Entry
Bcen2424_6193     CDS       T00415                                 

Definition
(GenBank) plasmid segregation oscillating ATPase ParF
  KO
K03496  
chromosome partitioning protein
Organism
bch  Burkholderia cenocepacia HI2424
Brite
Chromosome [BR:bch03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Bcen2424_6193
Cytoskeleton proteins [BR:bch04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   Bcen2424_6193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:354911..355606
Genome map
AA seq 231 aa AA seqDB search
MAFKIAVSNQKGGTGKTTISVNIAAAFEAGGNKVALIDADPQGTSVRWVTSGENTLPMTV
LSLAPAGRGIGGEIKKQDANFDVIVVDCPGNLEDPRIASVLEVADFCLVPLSPSPADLYS
TVAMIRMIESMRAVRNPQLSSALMLNSVNGKTKMREEILKILRAEEIGEHLLDSQIAQRE
VYRQTFALGTTIHHHNRYLKGLKEARAEIEKLVTEMAQYIASTRATGAAHG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaagatcgccgtcagtaatcaaaaaggtgggacgggaaagacgaccatctcc
gtcaacatcgcggctgcgttcgaagccggcggcaacaaagtcgcgttgatcgatgccgac
cctcagggcacttccgtccgttgggtcacgagcggcgagaacacgctgccgatgacggtc
ctttcgctggctcccgccggccgcggcatcgggggcgagatcaagaagcaggacgcgaac
tttgatgtgatcgtcgtcgactgccccggcaacctcgaagatccgcgtatcgcatccgtc
ctggaagtggccgacttctgcctggtgccgctttcgccatcgccggccgatctgtacagc
acggtcgcgatgatccgcatgatcgaatcgatgcgcgccgttcgaaatcctcaactttct
tccgcattaatgctgaatagcgtcaatggaaaaactaaaatgcgtgaagaaattttaaaa
attctacgggctgaagaaataggggagcatctgctcgacagccagatcgcgcaacgcgag
gtctatcgtcagacgttcgcgctcggcaccacgatccatcaccacaatcgatacctgaag
ggcctgaaggaagcccgcgcggaaatcgaaaagctggtcacggaaatggcccaatacatc
gcgtcgacgcgcgctaccggagccgcccatggctaa

DBGET integrated database retrieval system