KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6240Help
Entry
Bcen2424_6240     CDS       T00415                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bcen2424_6240 (deoA)
Enzymes [BR:bch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Bcen2424_6240 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:418173..419489
Genome map
AA seq 438 aa AA seqDB search
MFLPQEFIRRKRDGQPLDRDDMAAFVRGVTDGSVTEGQVAAFAMAVYFNDLSTDERVALT
LAQRDSGDVLDWRALDLGGPVIDKHSTGGVGDVVSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLSAIPGYDVMPDTDAFRRTVREVGVAIIGQTARLAPADKRIYAIRDVTATVESV
AMITASILSKKLAAGLDGLVMDVKVGSGAFMPTAEKSAELARSIVDVGNGAGMKTTAILT
DMNQSLAPCAGNALEVACAIDYLTGKSRPARLHDVTMALSAELLVTGGLARDAAHAREKL
QQALDSGAAAERFARMVAALGGPADLLDAPARHLARAAVIVPVPAPVSGVVQRVDCRALG
LAVVALGGGRTRAEDAIDVSVGLSALAEIGQRIEAGEPLGFVHARDEAAAAHAVDAIRRG
YVLGETGEAPPTLYQRVD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtttctaccgcaggaattcattcgcaggaagcgtgacgggcagccgctcgatcgcgac
gacatggccgcgttcgtgcgcggcgtgaccgacggcagcgtgaccgagggccaggtggcc
gcgttcgcgatggccgtgtatttcaacgacctgagcaccgacgagcgcgtcgcgctgacg
ctcgcgcagcgcgattcgggcgacgtgctcgactggcgcgcactcgatctcggcgggccg
gtgatcgacaagcattcgacgggcggcgtcggcgacgtcgtgtcgctgatgctcgggccg
atggtggccgcgtgcggcggctacgtgccgatgatctcggggcgcgggctcggccatacc
ggcggcacgctcgacaagttgagcgcgatccccggttacgacgtgatgcccgatacggat
gcgtttcgccgcacggtgcgcgaggtcggcgtcgcgatcatcgggcagaccgcgcggctc
gcgccggccgacaagcgcatctatgcgatccgcgacgtgacggcgaccgtcgaatcggtc
gcgatgatcaccgcgtcgatcttgtcgaagaagctcgcggcggggctcgacgggctcgtg
atggacgtcaaggtcggctccggcgcgttcatgccgaccgcggagaaatcggcggaactg
gcgcgcagcatcgtcgacgtcggcaatggcgccggcatgaagacgaccgcgatcctcacc
gacatgaaccagtcgctcgcgccgtgcgcgggcaatgcgctcgaggtggcgtgcgcgatc
gactacctgacgggcaagtcgcgtcccgcccgtttgcacgacgtgacgatggcgctgtcg
gcggagctgctcgtcaccggcgggctggcgcgcgatgccgcccatgcgcgcgagaagctg
cagcaggcgctcgattcgggcgcggccgccgagcgtttcgcgcgcatggtcgccgcgctc
ggcggcccggccgacctgctcgacgcgcccgcgcggcatctggcgcgggcggcggtgatc
gtgccggttccggctcccgtgagcggcgtggtgcagcgggtcgactgccgcgcgctcggg
ctcgcggtggtcgcgctcggcggcggccgcacgcgcgcggaggatgcgatcgacgtcagc
gtcggcttgtcggcgctcgcggagatcgggcagcgcatcgaggccggcgagccgctgggt
ttcgtgcacgcccgcgacgaagcggccgcggcccacgcggtggatgcgatccgccgcggc
tacgtgctcggcgagaccggcgaagcgccgccgaccctttaccagcgcgtcgactga

DBGET integrated database retrieval system