KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6371Help
Entry
Bcen2424_6371     CDS       T00415                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bch00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bch00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:569428..570591
Genome map
AA seq 387 aa AA seqDB search
MKRRWPRQPMLVMGVFATFGLHAAVASAAPEVSISRADYGTTATGQAVSQYTLANRRGVT
LKVITYGGIVTALDVPDRTGHAADIVLGFDSLRDYEAHNGNIHFGALIGRYANRIAGGRF
ALDGKTWKLPVNDGPNTLHGGPDSFDAKVWTVTGTHSDATGSSVTLRYVSPDGENGFPGT
LTTDVTYTLTGDNQIRIDYRATTDKNTVVNLTNHSYFNLAGQAGGSVERQLIEIAASRFT
PTDDTSIPTGQLASVAGTPMDLRQPTPIGAHLRDAYPQLAIAHGYDQNWVLDQGGQPAPA
FAARAYDPASGRFLELYTTQPGLQFYTANGLNGSVAGKGGTVYRQTDAFALEAEHFPDSP
NHPAFPSTALKPGETLHEVTVWRVGAR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacgctggccgcgacaaccgatgctcgtgatgggtgtgttcgcaacgttcggg
ctgcacgcagccgttgcatcggcggcgcccgaagtctcgatcagccgagccgattacggg
acgaccgcgaccgggcaggcggtgagccagtacacgctcgcgaaccggcgcggcgtgacg
ctgaaagtcatcacgtacggcggtatcgtgaccgcgctcgacgtgcccgaccgcaccggg
cacgcggccgacatcgtgctcggcttcgattcgctgcgcgactacgaggcgcacaacggc
aacatccatttcggcgcgctgatcggccggtatgcgaaccgcatcgcgggcgggcgcttc
gcgctcgacggcaagacgtggaagctgccggtcaacgacgggccgaacacgctgcacggc
ggccccgacagtttcgacgcgaaggtctggacggtcaccggcacgcacagcgacgcgacc
ggttcgagcgtcacgctgcgctacgtgagccccgacggcgagaacggcttccccggcacg
ttgacgacggacgtgacctatacgctgaccggcgacaaccagatccgcatcgactaccgc
gccacgacggacaagaacacggtcgtcaacctgaccaaccacagctacttcaatctggcc
gggcaggcgggcggcagcgtcgagcggcaactgatcgagatcgccgcatcgcgcttcacg
ccgaccgacgatacgtcgattccgaccgggcaactggcgagcgtcgcgggcacgccgatg
gacctgcgccagccgacgccgatcggcgcgcatttgcgcgatgcgtatccgcagctcgcg
atcgcgcatggctacgaccagaactgggtgctcgaccagggcggccagccggcgccggcg
ttcgccgcgcgtgcctacgacccggcgtcggggcgtttcctcgagctgtacacgacgcag
ccggggctgcagttctatacggccaacgggttgaacggcagcgtcgcgggcaagggcggc
acggtctaccggcaaaccgatgcattcgcgctggaagccgagcatttccccgattcgccg
aatcatccggccttcccgtcgacggcgctcaagccgggcgagacgctgcacgaagtgacg
gtgtggcgggtgggcgcgcgatga

DBGET integrated database retrieval system