KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6482Help
Entry
Bcen2424_6482     CDS       T00415                                 

Definition
(GenBank) Ku domain protein
  KO
K10979  
DNA end-binding protein Ku
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bch00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Bcen2424_6482
DNA repair and recombination proteins [BR:bch03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bcen2424_6482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:694369..695388
Genome map
AA seq 339 aa AA seqDB search
MAPRMIWKGAISFGLVHVPVQLFPATRTVKPSFRMLDKRSMDPIGYRQINKRTGKEVTRE
DIVRGYEYEKERYVVLTDDEIRAANPESTQTVDILTFVDEDAVSFLYLDTPYYLVPDRKG
EKVYALLRDALKDSGKIGIALVVMRDRQHLGALIPVGPMLALDTLRWQEELRPLDELSVP
ADDAKGAGVTARELGMAKKLIDDMSGKWTPDEYHDTFRDDILELVERKVRAGKIEEIEDR
PAQTGRAASNVVDLTELLKRSLKGGAGARAADLRAERGEGEDEASSSSSSRGGARRKPAA
KSASKGAATKTAAKKTAAKRGAASAPAAKKTAARRKHAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcggatgatttggaaaggcgcgatcagcttcgggctcgtgcacgtgcccgtg
cagttgtttccggcgacgcgcaccgtgaaaccgtcgttccggatgctcgacaagcgctcg
atggacccgatcggctatcggcagatcaacaagcgcaccggcaaggaggtcacgcgcgag
gacatcgtgcgcggctacgaatacgagaaggagcgctacgtcgtgctcaccgacgacgag
atccgcgcggcgaacccggaatcgacgcagaccgtcgacatcctgaccttcgtcgacgag
gacgccgtgtcgttcctctatctcgacacgccgtactacctggtgccggaccgcaagggc
gagaaggtctatgcgctgctgcgcgacgcgctgaaggacagcggcaagatcggcatcgcg
ctggtggtgatgcgcgaccgccagcaccttggcgcgctgatcccggtcgggccgatgctc
gccctcgatacgctgcgctggcaggaggaactgcggccgctcgacgagctgtcggtgccg
gccgacgacgcgaagggcgcgggcgtcaccgcgcgcgagctcgggatggcgaagaagctg
atcgacgacatgtccggcaaatggacccccgacgaatatcacgacacgttccgcgacgac
atcctcgagctggtcgagcgcaaggtgcgcgcgggcaagatcgaggagatcgaggaccgg
cccgcgcagaccggccgcgcggcgagcaacgtggtcgatctcaccgagctgctgaagcgc
agcctgaagggcggcgcgggggcgcgcgcggcggatctgcgtgcagagcgtggcgaaggg
gaggacgaggcgtcttcatcgtcgtcgtcgcgcggcggcgcgcgccgcaagccggcggcg
aaatccgcatcgaagggcgcggcgacgaaaaccgcggcgaagaagaccgccgcgaaacgc
ggcgcggcgagcgcccccgcggcaaagaagacggccgcgcgccgcaagcacgcggcgtga

DBGET integrated database retrieval system