KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6485Help
Entry
Bcen2424_6485     CDS       T00415                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3175
Motif
Other DBs
NCBI-ProteinID: ABK13215
JGI: Bcen24246485
Position
3:complement(699650..700018)
Genome map
AA seq 122 aa AA seqDB search
MPSASASHAHDKPHGKRHTRHPGRARSADPAHRKRWSGKVTQKSDALDIEPDIFKSDDPA
AIAASLKRSAEHSRRRKASPFQSAMSMLNFYVNRAGRNLPKTRRATLERAKRKLREAFGR
KP
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgccttccgcttctgcttcccacgcgcacgacaagccgcacggcaagcgccacacgcgc
caccccggccgcgcacgcagcgccgatccggcccaccgcaagcgctggtccggcaaagtc
acgcaaaagagcgatgcgctcgacatcgagcccgacatcttcaaatccgacgatccggcc
gcgatcgccgcgtcgctgaagcgctcggccgaacacagccgccgccgcaaggcgtcgccg
ttccagtcggcgatgtcgatgctgaacttctacgtgaaccgcgccggccgcaatctgccg
aaaacgcgccgcgcgacgctcgaacgcgcgaagcggaaactgcgcgaagccttcggccgc
aagccctga

DBGET integrated database retrieval system