KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6488Help
Entry
Bcen2424_6488     CDS       T00415                                 

Definition
(GenBank) intracellular protease, PfpI family
  KO
K05520  
protease I [EC:3.5.1.124]
Organism
bch  Burkholderia cenocepacia HI2424
Brite
Enzymes [BR:bch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     Bcen2424_6488
Peptidases [BR:bch01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   Bcen2424_6488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:701325..701873
Genome map
AA seq 182 aa AA seqDB search
MSGKLDHCKVAILAVDGFEEAELVEPQRALAAEGAQVDVISQKRGEIQGFRHVDKGERVK
VDRTFDDAREGDYDAVVLPGGVINGDAIRMVPAAREFVTAAVGAGKPVAAICHGGWLLVS
AGLVEGKTMTSWPSLQDDIRHAGGKWVDEEVVRDGNLITSRKPADLPAFNGALVERLASR
GA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaagctggatcattgcaaggtagcgattctcgcggtcgacggtttcgaggaa
gccgaactcgtcgaaccgcagcgcgcgctcgcggccgaaggcgcgcaggtggacgtgatt
tcgcagaagcgcggcgaaatccagggtttccggcacgtcgacaagggcgagcgcgtgaag
gtcgaccgcacgttcgacgatgcacgcgaaggcgactacgacgcggtcgtgctgccgggc
ggcgtcatcaacggcgacgcgatccggatggtgccggccgcgcgcgaattcgtgacggcg
gccgtcggcgccggcaagccagtcgcggcgatctgccacggcgggtggctcctcgtgtcg
gccgggctggtcgagggcaagacgatgacgagctggccgagcctgcaggacgatatccgc
cacgcgggcggcaagtgggtggacgaggaggtcgtgcgcgacggcaacctgatcacgagc
cgcaagccggccgatctgcccgcgttcaacggcgcgctggtcgagcgcctcgcgtcgcgg
ggggcatga

DBGET integrated database retrieval system