KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6497Help
Entry
Bcen2424_6497     CDS       T00415                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcen2424_6497
Enzymes [BR:bch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bcen2424_6497
Exosome [BR:bch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcen2424_6497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(713563..715773)
Genome map
AA seq 736 aa AA seqDB search
MTDTLFDRADIDALLAGRHPDPFACLGPHRHDDQIVVRALLPGAERVRALSPDGAELGTL
ACVDRAGCFAGTIAHDGGAPHYLLSIDWPDAHQVTDDAYAFGTLLDEAALARFSAGDPEA
VLDCLGATPVRIDDTDGVRFAVWAPSAQRVSVVGDFNAWDGRRHPMRLRRPSGVWELFVP
GIGAGERYKYELCAADGRVLPHKADPCARATEAPPRTASVVADVAALHAFAWHDDGWMHA
RPRHDDRYRVPWSIYEVHPESWQRIPEQMDRSATWDELAERLIPYVKGMGFTHVEFMPIA
EYPFGGSWGYQPLAQFAPSARFGPVEGFARFVDRAHAAGIGVLVDWVPAHFPNDAHGLAQ
FDGSALYEHADPREGMHPDWNTCVFNVGRTEVSAFLVASALAWARRYHVDGIRVDAVASM
LYRDYSRKEGEWVPNVYGGRENLESVAFLRRLNDTLHGDAAPAGVVTVAEESTAWPGVTA
PTADGGLGFDFKWNMGWMHDTLAYLHEDPIHRRYHHDRMTFGLVYAFSERFVLPLSHDEV
VHGKGSLVAKMPGDAWQRLATLRAYFGFMWAHPGKKLLFMGSEFAQWSEFAHDATPHWDL
LDAPAHRGVQRLVRDLNRAYAAEPALHALDCHAAGFAWLIGDDRDNSVFAFARRDDTGRL
VVAVCNFTPVPRAGYRLGLPAPGHWRELMNTDAASYGGTNAGNDGAVWAEAVPAHGEAWS
ASLRLPPLATLWLTPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacgctgttcgaccgcgccgatatcgatgcgctgctcgccggccgccatccc
gacccgttcgcgtgcctcggcccgcaccgacacgatgaccagatcgtcgtgcgggcgctg
ctgcccggcgccgagcgcgtgcgcgcgctgtcgccggacggcgccgaactcggcacgctc
gcgtgcgtcgatcgcgcgggctgcttcgcggggacgatcgcgcacgatggcggcgcgccg
cactatctgctctcgatcgactggccggacgcgcatcaggtgaccgacgatgcgtacgcg
ttcggcacgctgctcgacgaagcagcgcttgcgcgtttttcggccggcgatcccgaagcc
gtgctcgactgcctcggcgcgacaccggtgcgcatcgacgacaccgacggcgtgcggttc
gcggtgtgggcgccgagcgcgcagcgcgtgtcggtggtcggcgatttcaacgcatgggac
ggacgccgccatccgatgcggctgcggcggccgtcgggcgtgtgggagctgttcgtgccg
ggcatcggagcgggcgagcgctacaagtacgagctgtgcgcggccgacgggcgcgtgctg
ccgcacaaggccgatccgtgcgcacgggcgaccgaggcgccgccgcgcacggcgtcggtg
gtcgccgacgtcgcggcgctccacgcgttcgcctggcacgacgacggctggatgcacgca
cggccgcgccacgacgaccgctaccgcgtgccgtggtcgatctacgaggtccatccggag
tcgtggcagcgcatccccgaacagatggaccgcagcgcgacgtgggacgaactcgccgag
cggctgattccgtacgtgaaggggatgggcttcacgcacgtcgaattcatgccgatcgcc
gaatacccgttcggcggctcgtggggctaccagccgctcgcgcagttcgcgccgtccgcg
cgcttcgggccggtcgagggcttcgcgcgcttcgtcgatcgtgcgcacgcggccggcatc
ggcgtgctcgtcgactgggtgcccgcgcattttccgaacgacgcgcacgggctcgcgcaa
ttcgacggcagcgcgctgtacgagcatgccgacccgcgcgaggggatgcaccccgactgg
aacacctgcgtgttcaacgtcgggcgcaccgaggtcagtgcgttcctcgtcgcgtcggcg
ctcgcgtgggcgcgccgctatcacgtcgacggcatccgcgtcgacgcggtcgcgtcgatg
ctgtatcgcgactattcgcgcaaggaaggcgaatgggtgccgaacgtgtacggcggccgc
gaaaacctcgaatcggtcgcgttcctgcgccggctgaacgacacgctgcacggtgacgcc
gcgccggccggcgtcgtcaccgtcgcggaggagtcgaccgcgtggccgggcgtcaccgcg
ccgaccgccgacggcgggctcggcttcgacttcaagtggaacatgggctggatgcacgac
acgctcgcgtacctgcacgaagacccgatccaccgccgctatcaccacgaccggatgacg
ttcgggctcgtgtacgcgttctccgagcgcttcgtgctgccgctgtcgcacgacgaggtc
gtgcacggcaagggctcgctcgtcgcgaagatgcccggcgacgcgtggcagcggctcgcg
acgctgcgcgcgtatttcggcttcatgtgggcacaccccggcaagaagctgctgttcatg
ggcagcgaattcgcgcagtggagcgagttcgcgcacgacgcgacgccgcactgggatttg
ctcgacgcgcccgcgcatcgcggcgtgcagcggctcgtgcgcgatctcaaccgcgcgtac
gcggccgagccggcgctgcatgcgctcgactgccacgcggccggcttcgcctggctgatc
ggcgacgaccgcgacaacagcgtgttcgcgttcgcgcgccgcgacgatacggggcgcctg
gtggtcgccgtctgcaacttcacgcccgtgccgcgcgccggttatcggctcggcctgccc
gcgcccggccactggcgcgaactgatgaacaccgatgccgcgtcgtacggcggcaccaac
gccggcaacgacggcgccgtgtgggccgaagccgtgcccgcgcacggcgaggcgtggtcg
gcgagcttgcgcctgccgccgctcgcgacgctctggttgacccctgcctga

DBGET integrated database retrieval system