KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6503Help
Entry
Bcen2424_6503     CDS       T00415                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mac
Motif
Other DBs
NCBI-ProteinID: ABK13233
JGI: Bcen24246503
Position
3:complement(726224..726547)
Genome map
AA seq 107 aa AA seqDB search
MTQTDLLSYLVTSQLAARMRSGTWLTTSQLVGALRAWLACQHAECDWLDRIRIAHASATI
AQEIYDIAVADGEHARLDAHSPELQGLRARCDALLQRIDGNRDVGAR
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagaccgacctgctctcctatctcgtgacgagccagctcgccgcgcgcatgcgc
agcggaacgtggctcacgaccagccagctggtgggcgcgctgcgcgcgtggctcgcgtgc
cagcacgccgaatgcgactggctcgaccggatcaggatcgcgcacgcgtcggcgacgatc
gcgcaggagatctacgacatcgcggtcgcggatggcgagcatgcgcggctcgacgcgcat
tcgccggagttgcaggggcttcgggcacgctgcgatgcgctgctgcagcggatcgacggc
aaccgggacgtcggggcccgatga

DBGET integrated database retrieval system