KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6505Help
Entry
Bcen2424_6505     CDS       T00415                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:727366..727659
Genome map
AA seq 97 aa AA seqDB search
MRRAFFASLSQIRQEATVAHQQDAQVRDPYRGHEIFVWARPNERGAWRDEVQVYVNGARI
ELVVPEAAGPEWLTEVEALRAGLERGRYLIDKRVDDD
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgcattttttgcatcgctatcgcagataagacaggaggccaccgtggcacat
caacaggacgcacaggttcgggacccgtatcgcggccacgagattttcgtgtgggcgcga
cccaacgagcgcggcgcatggcgcgacgaggtgcaggtgtacgtcaacggcgcacgcatc
gagctggtggtgccggaagccgccggccccgaatggctgaccgaggtcgaggcgctgcgg
gcgggcctcgagcgcggccgctatctgatcgacaagcgcgtggacgacgattga

DBGET integrated database retrieval system