KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6506Help
Entry
Bcen2424_6506     CDS       T00415                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  
succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcen2424_6506
   00650 Butanoate metabolism
    Bcen2424_6506
  Energy metabolism
   00190 Oxidative phosphorylation
    Bcen2424_6506
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bcen2424_6506
    1.3.5.4  fumarate reductase (quinol)
     Bcen2424_6506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:727752..728459
Genome map
AA seq 235 aa AA seqDB search
MSDPRTLHIYRYDPDRDAAPYMQRYEIDVNPDDRMLLDVLGRVKCDDETLSYRRSCREGI
CGSDAMNINGKNGLACLTNMQTLPREIVLRPLPGLPVVRDLIVDMTDFFNQYHSIRPYLI
NDTTPPARERLQSPEERDQLDGLYECILCACCSTSCPSYWWNPDKFVGPAGLLQAYRFIA
DSRDLATAERLDDLEDPYRLFRCRTIMNCTDVCPKGLNPTKAISEIRTMLVRRTV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccgcgcaccttgcatatctatcgctacgaccccgaccgcgacgcggcgcct
tacatgcagcgctacgagatcgacgtgaatccggacgaccgcatgctgctcgacgtgctg
ggccgcgtgaagtgcgacgacgagacgctgtcgtatcggcgctcctgccgcgaaggcatc
tgcggctcggacgcgatgaacatcaacggcaagaacggcctcgcatgcctgaccaacatg
cagacgctgccgcgcgaaatcgtgctgcggccattgccggggctgccggtggtgcgcgac
ctgatcgtcgacatgaccgatttcttcaaccagtaccactcgatccggccatacctgatc
aacgacacgacgccgcccgcgcgcgagcggctgcaatcgccggaggagcgcgaccagctc
gacgggctgtacgaatgcatcctgtgcgcgtgctgttcgacgtcgtgcccgagctactgg
tggaacccggacaagttcgtcggtcccgccgggctgctgcaggcgtatcgcttcatcgcc
gattcgcgcgatctcgcgacggccgagcggctcgacgatctcgaggacccgtaccggctg
ttccgctgccggacgatcatgaattgcacggacgtgtgcccgaaggggctgaatccgacc
aaggcgatttcggagatccggacgatgctggtcaggcggacggtgtga

DBGET integrated database retrieval system