KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6508Help
Entry
Bcen2424_6508     CDS       T00415                                 

Definition
(GenBank) Rieske (2Fe-2S) domain protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:complement(729543..730598)
Genome map
AA seq 351 aa AA seqDB search
MHAPLPLVPEPAAASRHRYPDGWFALAYSRDVKPGALVVTRFMGADVVLYRTASGLIRAV
APHCPHLGAHLGHGGVVRGEEIVCPFHHLAFAPDGTCVRAGRDGKPPAATLRQRPVCEWN
GLVLAWQDRAGAAPSWSLPELDLDGYSRPRGQCHTLNGSLQNPAENGVDINHFSPVHGWS
NPVLEPPQADGHRLTMRSTLVLLGQRLLLDITMHGLGCMAARMELPDLGLHARVVLFPTQ
IEPDRWTCREFVALRVERASAWPSPLRRALHEVLASAAYRLWFVPQFKRDLRIWDHRDYD
ARPTLMAGELPIMTFRRWAAQFYPAPGGDAPDGRDGPVSAAIAHADREFAR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaccgctccctcttgtgcccgaacccgccgctgcttcgcgacatcgctatccg
gacggctggttcgcgctggcctacagccgcgacgtcaaaccaggcgcgctcgtcgtaacg
cgcttcatgggcgcggacgtcgtgctgtatcgaacggcatccggcctgattcgcgcggtc
gcgccgcattgtccgcacctcggcgcgcatctcgggcacggcggcgtcgtgcgcggcgag
gagatcgtatgcccgttccatcacctcgcgttcgcgccggacggcacctgcgtgcgcgcc
gggcgcgacggcaagccgcccgccgccacgctgcggcagcgccccgtatgcgaatggaac
ggcctcgtgctcgcatggcaggaccgtgcgggcgcagcgccgtcgtggtcgctgcccgaa
ctcgacctcgacggctattcgcggccgcgcggccagtgccacacgctgaacggcagcctg
cagaatccggccgagaacggcgtcgacatcaatcatttcagcccggtgcacggctggtcg
aacccggtgctggagccgccgcaagccgacggccaccggctgacgatgcgctcgacgctc
gtgctgctcgggcagcggctgctgctggacatcacgatgcacggcctgggctgcatggcc
gcgcgcatggaactgccggacctcgggctgcacgcgcgggtcgtgctgttcccgacgcag
atcgaacccgatcgctggacctgccgcgaattcgtcgcgctgcgcgtcgaacgtgcgtcg
gcgtggccgtcgccgctgcgccgggccctgcacgaggtcctcgcgagcgccgcataccgg
ctgtggttcgtgccgcaattcaagcgcgacctgcgcatctgggatcaccgcgactacgac
gcacgcccgacgctgatggccggcgagctgccgatcatgacgttccggcgctgggccgcg
cagttctacccggcgcccggcggcgacgcacccgacgggcgagacggccccgtgtcggcg
gccatcgcacatgccgatcgggaattcgcgcgatga

DBGET integrated database retrieval system