KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6510Help
Entry
Bcen2424_6510     CDS       T00415                                 

Definition
(GenBank) Methyltransferase type 12
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:complement(731719..732681)
Genome map
AA seq 320 aa AA seqDB search
MNQISEQAIAELRAPHLEPALPIRVLHGETVSDYERKVQTTYAGSPDDWRKAIGEYLLFQ
FGVYDDPRSTPPISLDESGIRYFERQLHLAGFDDPVPARVERILDIGCGWGYILKYLAGR
FPGCMRLDGINVSREQLDYCARFHAQHGLAERINLYQCNAQDVDRLPDPATPYDLVIIRG
VISHFPNALYEKAMRALHARVRGGGSVVISDNLYNVDLSEYASDTPDEVDRIACKHRKTP
DYFRQVLIDAGFAIRDMRVLPSNIDVARWLMDAKANIDRHFPHRAPDTLEELRVLAENWS
VALIKNKVSTYSIVAVKPDA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatcagcgaacaggcgatcgccgaactgcgcgcgccgcacctggaacccgcc
ctgccgatccgggtgctgcatggcgagacggtgagcgattacgagcggaaagtgcagacg
acctacgccggcagcccggacgactggcgcaaggcgatcggcgagtacctgttgttccag
ttcggtgtgtacgacgatccgcgctccacgccgccgatctcgctcgatgaatcgggcatt
cgctacttcgaacgccagcttcatctcgccggcttcgacgaccccgttcccgcccgggtc
gaacgcattctcgacatcggctgcggctggggctacatcctcaagtatctggccggccgc
ttccccggctgcatgcgcctcgacggtatcaacgtcagtcgcgaacagctcgactactgc
gcccgctttcatgcgcaacacgggctcgcggaacgcatcaacctgtatcagtgcaacgca
caggacgtcgatcgactgcccgatcccgcgacaccatacgatctcgtgatcattcgcggc
gtgatctcgcatttcccgaacgcgctgtacgaaaaggcgatgcgcgcgctgcatgcgcgt
gtacgcggcggcggctcggtggtcatctcggacaatctgtacaacgtcgacctgagcgaa
tacgcgtccgacacgcccgacgaggtcgaccggatcgcatgcaagcaccgcaagacgccc
gattatttcaggcaggtgctgatcgacgccgggttcgcgatccgcgacatgcgcgtgctg
ccgtcgaacatcgacgtcgcgcgctggctgatggatgccaaggccaacatcgaccgccat
tttccgcaccgtgcgccggacacgctggaagaactgcgcgtgctcgccgaaaactggtcc
gtcgcgctgatcaagaacaaggtgtcgacctacagcatcgtcgcggtcaaaccggacgcg
taa

DBGET integrated database retrieval system