KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6515Help
Entry
Bcen2424_6515     CDS       T00415                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:736364..737266
Genome map
AA seq 300 aa AA seqDB search
MLNRLDILKIFAAAAAAPTFREAAARLGVSPQVVTRAVRELEEMLGETLFHRTTRSIRIT
AFGQSFAREVQGALAVVDGLFGPATGQRDEPVGVVRITAPSGMGRHYVQPILTGLMQRYP
GLVPDLRLSDVPSPVVDEQIDIGVRVGAIGDNRFVARMVGPLPMWVVAAPSLIRRLGEPK
NRKALEAMPVTCLIDRASGRPWPWMFRGEQQFVPSSPAYLTDDTEVEIEAVCAGVGVGQC
SEYLVRPYVRKGRLVRVLPSLEPEPWKLHVYRPRRGPMPRRIRVVYDELVAKLAEATWRE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaccgcctcgacatcctgaagatctttgccgcggccgccgcggcgccgacgttt
cgcgaggcggccgcgcggctcggcgtgtcgccgcaggtcgtcacgcgcgcggtgcgcgaa
ctggaggagatgctcggcgaaacgctgtttcaccggacgacccgcagcatccggatcacc
gcgttcggccagtcgttcgcgcgcgaggtgcagggcgcgctggccgtggtcgacgggctg
ttcgggcccgcgaccggccagcgcgacgagccggtcggcgtcgtccggatcaccgcgccg
tcgggcatggggcggcattacgtgcagccgatcctcaccggcctcatgcagcgatatccg
gggctcgtgcccgatctgcggctgtcggacgtgccgtcgccggtggtcgacgagcagatc
gacatcggcgtgcgtgtcggcgcgatcggcgacaaccgcttcgtcgcgcgcatggtcggg
ccgctgccgatgtgggtggtggccgcgccgtcgctgatccggcggctgggcgagccgaaa
aaccgcaaggcactcgaagcgatgccggtgacgtgcctgatcgatcgtgcaagcgggcgg
ccgtggccgtggatgtttcgcggcgagcagcagttcgtgccgtcgtcgccggcttacctg
acggacgacaccgaggtggagatcgaggccgtgtgcgcgggggtgggagtcggccagtgt
tcggaatatctggtgcggccgtacgtcaggaaggggcgcctcgtgcgggtgttgccgagc
ctcgagcccgagccgtggaagctgcacgtctatcggccgcggcgcgggccgatgccgcgt
cgtatccgggtggtgtacgacgaactggtggcgaagctcgcggaggcgacgtggcgggag
tag

DBGET integrated database retrieval system