KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6518Help
Entry
Bcen2424_6518     CDS       T00415                                 

Definition
(GenBank) benzaldehyde dehydrogenase (NAD+)
  KO
K00141  benzaldehyde dehydrogenase (NAD) [EC:1.2.1.28]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00622  Xylene degradation
bch00623  Toluene degradation
bch00627  Aminobenzoate degradation
bch01100  Metabolic pathways
bch01120  Microbial metabolism in diverse environments
bch01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bcen2424_6518
   00623 Toluene degradation
    Bcen2424_6518
   00622 Xylene degradation
    Bcen2424_6518
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.28  benzaldehyde dehydrogenase (NAD+)
     Bcen2424_6518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABK13248
JGI: Bcen24246518
Position
3:complement(739871..741340)
Genome map
AA seq 489 aa AA seqDB search
MDSNTPALFDTDIWRGKTFTGRWHASPHAADVIEPATGNTLGRIGLADSSAIAEASATAH
RAQPAWFALPYDDRAAVLRRAAAVAETHADAIVDWLVRESGSTRAKAAFETSVTIKALHE
AAGLPSRAAGEVLPSAAGRLSLARRRPRGVVGVISPFNFPLYLAIRAVAPALALGNAVVL
KPDPRTAVCGGIAIARVFELAGLPEGVLHVLPGDGAAGAALVADPHVAMIQFTGSTAAGR
KVGEAAGRHLKKVSLELGGKNSLIVLDDADLDRAVANTAWGAYLHQGQICMATGRVLVQR
AIHDRFVAKLVEKARSLRVGDPATGDVGLGPLINAAQRDHAASVVDAARRAGARIETGGG
HRGLFFEPTVLSGVAPGNPAFDEEIFGPVAIVVPFDTDEDAIALANRTEYGLSMAILSAD
VGRALRIGERLNTGLLHINDQTVNDEVINPFGGVGASGNGSSIGGAANWEEFTQWQWLTI
KGEAPPYPI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggatagcaacacccccgcactgttcgacaccgacatctggcgcggcaagaccttcacc
ggccgctggcatgcgagcccgcatgcggccgacgtgatcgagccggcgaccggcaacacg
ctcggccgcatcggtcttgccgacagctcggccatcgccgaagcatcagcgaccgcgcac
cgcgcccagcccgcctggttcgccctgccctacgacgaccgcgcagccgtcctgcgccgc
gccgcagccgtcgccgaaacgcacgccgatgcgatcgtcgactggctcgtgcgcgaaagc
ggctcgacgcgcgcgaaggcggcgttcgaaacgtccgtcacgatcaaggcgctgcacgaa
gcggccgggctgccatctcgcgcggccggcgaagtgctgccatcagcagccggccggctg
tcgctcgcgcgccgccgcccgcgcggcgtggtcggcgtgatctcgccgttcaatttcccg
ctgtacctcgcgattcgtgcggtcgcgccggcgctcgcgctcggcaacgcggtcgtgctg
aagcccgatccgcgcaccgccgtgtgcggcggcatcgcgatcgcccgcgtgttcgagctc
gccggcctgcccgaaggcgtgctgcacgtgctgcccggcgacggcgcggccggcgcggcg
ctggtcgccgatccgcacgtcgcgatgatccagttcaccggctccaccgcggccggacgc
aaggtgggcgaagcggccggccgccacctgaagaaggtatcgctcgaactcggcggcaag
aactcgctgatcgtgctcgacgatgccgacctcgaccgcgcggtcgcgaacaccgcatgg
ggcgcgtatttgcatcaaggccagatctgcatggcgaccggccgcgtgctcgtacagcgc
gcgattcacgaccgcttcgtcgcgaagctcgtcgagaaagcgcgcagcctgcgcgtcggc
gacccggccaccggcgacgtcggcctcggcccgctgatcaacgccgcgcaacgcgaccat
gcggcgagcgtggtcgatgcggcccgccgcgcaggtgcacgcatcgagacgggcggcggc
catcgcggcctgttcttcgagccgaccgtgctgagcggcgtcgcgccgggcaatccggcg
ttcgacgaggaaattttcgggccggtcgcgatcgtcgtgccgttcgataccgacgaggac
gcgatcgcgctcgcgaaccggaccgaatacgggctgtcgatggcgatcctgtccgccgac
gtcggacgcgcactgcggatcggcgagcgcctgaacacggggctgctgcacatcaacgac
cagacggtcaacgacgaagtgatcaacccgttcggcggtgtcggcgcatcgggtaatggc
tcgagcatcggcggtgcggcaaactgggaggaattcacgcagtggcagtggctgacgatc
aagggcgaagcgccgccgtatccgatttga

DBGET integrated database retrieval system