KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6518Help
Entry
Bcen2424_6518     CDS       T00415                                 

Definition
(GenBank) benzaldehyde dehydrogenase (NAD+)
  KO
K00141  
benzaldehyde dehydrogenase (NAD) [EC:1.2.1.28]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Xylene degradation
Toluene degradation
Aminobenzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bcen2424_6518
   00623 Toluene degradation
    Bcen2424_6518
   00622 Xylene degradation
    Bcen2424_6518
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.28  benzaldehyde dehydrogenase (NAD+)
     Bcen2424_6518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:complement(739871..741340)
Genome map
AA seq 489 aa AA seqDB search
MDSNTPALFDTDIWRGKTFTGRWHASPHAADVIEPATGNTLGRIGLADSSAIAEASATAH
RAQPAWFALPYDDRAAVLRRAAAVAETHADAIVDWLVRESGSTRAKAAFETSVTIKALHE
AAGLPSRAAGEVLPSAAGRLSLARRRPRGVVGVISPFNFPLYLAIRAVAPALALGNAVVL
KPDPRTAVCGGIAIARVFELAGLPEGVLHVLPGDGAAGAALVADPHVAMIQFTGSTAAGR
KVGEAAGRHLKKVSLELGGKNSLIVLDDADLDRAVANTAWGAYLHQGQICMATGRVLVQR
AIHDRFVAKLVEKARSLRVGDPATGDVGLGPLINAAQRDHAASVVDAARRAGARIETGGG
HRGLFFEPTVLSGVAPGNPAFDEEIFGPVAIVVPFDTDEDAIALANRTEYGLSMAILSAD
VGRALRIGERLNTGLLHINDQTVNDEVINPFGGVGASGNGSSIGGAANWEEFTQWQWLTI
KGEAPPYPI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggatagcaacacccccgcactgttcgacaccgacatctggcgcggcaagaccttcacc
ggccgctggcatgcgagcccgcatgcggccgacgtgatcgagccggcgaccggcaacacg
ctcggccgcatcggtcttgccgacagctcggccatcgccgaagcatcagcgaccgcgcac
cgcgcccagcccgcctggttcgccctgccctacgacgaccgcgcagccgtcctgcgccgc
gccgcagccgtcgccgaaacgcacgccgatgcgatcgtcgactggctcgtgcgcgaaagc
ggctcgacgcgcgcgaaggcggcgttcgaaacgtccgtcacgatcaaggcgctgcacgaa
gcggccgggctgccatctcgcgcggccggcgaagtgctgccatcagcagccggccggctg
tcgctcgcgcgccgccgcccgcgcggcgtggtcggcgtgatctcgccgttcaatttcccg
ctgtacctcgcgattcgtgcggtcgcgccggcgctcgcgctcggcaacgcggtcgtgctg
aagcccgatccgcgcaccgccgtgtgcggcggcatcgcgatcgcccgcgtgttcgagctc
gccggcctgcccgaaggcgtgctgcacgtgctgcccggcgacggcgcggccggcgcggcg
ctggtcgccgatccgcacgtcgcgatgatccagttcaccggctccaccgcggccggacgc
aaggtgggcgaagcggccggccgccacctgaagaaggtatcgctcgaactcggcggcaag
aactcgctgatcgtgctcgacgatgccgacctcgaccgcgcggtcgcgaacaccgcatgg
ggcgcgtatttgcatcaaggccagatctgcatggcgaccggccgcgtgctcgtacagcgc
gcgattcacgaccgcttcgtcgcgaagctcgtcgagaaagcgcgcagcctgcgcgtcggc
gacccggccaccggcgacgtcggcctcggcccgctgatcaacgccgcgcaacgcgaccat
gcggcgagcgtggtcgatgcggcccgccgcgcaggtgcacgcatcgagacgggcggcggc
catcgcggcctgttcttcgagccgaccgtgctgagcggcgtcgcgccgggcaatccggcg
ttcgacgaggaaattttcgggccggtcgcgatcgtcgtgccgttcgataccgacgaggac
gcgatcgcgctcgcgaaccggaccgaatacgggctgtcgatggcgatcctgtccgccgac
gtcggacgcgcactgcggatcggcgagcgcctgaacacggggctgctgcacatcaacgac
cagacggtcaacgacgaagtgatcaacccgttcggcggtgtcggcgcatcgggtaatggc
tcgagcatcggcggtgcggcaaactgggaggaattcacgcagtggcagtggctgacgatc
aagggcgaagcgccgccgtatccgatttga

DBGET integrated database retrieval system