KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6519Help
Entry
Bcen2424_6519     CDS       T00415                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC Cupin_2 AraC_binding HTH_23
Motif
Other DBs
NCBI-ProteinID: ABK13249
JGI: Bcen24246519
Position
3:complement(741712..742566)
Genome map
AA seq 284 aa AA seqDB search
MFYQTSKSHIPADRVAATRRITMADYVTSWHEHEEFMFLLPSQGTLTLTSECSKHSQRIG
AGVLAMVPAGIFHDTASNPGEHCHTAVYAERDFVSFCARKSNVRIDGGDAPRYCVPPPAL
LGALRLQTQFDAGDETEEAHDMARYQNDLVDRLIASACVAAVLGAAPSDANPKVSRGQLV
SEIKAYLDVMLAERIDIETIASEFAISRRHLTRIFREETGESLTDYQLRQRVMRARSLLN
VPGTTVLSAALSVGIESPSYLARLFTKFGLPAPRDLKASRARCN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttttatcagacgtccaaatcgcacattcccgccgaccgcgtggctgcgacccgtcgc
atcacgatggccgattacgtgacgtcgtggcacgagcacgaagagttcatgttcctgttg
ccgagtcaaggcacgctgacgctgacttcggagtgttcaaaacattcgcaacgcatcggc
gccggcgtgcttgcgatggttcctgccgggatttttcacgacacggcgagcaatcccgga
gagcactgccatacggcggtctatgcggagcgcgacttcgtttcgttttgtgcgcgcaaa
tccaatgtccggatcgacgggggcgatgcaccgcgctactgcgtgccgccgcctgctctg
cttggggcactgcgtttgcaaacacagttcgacgcgggcgacgaaacggaggaagcgcac
gatatggcgcggtatcagaacgatctggtcgatcggctgattgcgtcggcgtgcgtggcg
gcggtgctcggcgccgcaccgagcgatgccaatccgaaggtttcgcgcgggcaactggtc
agtgaaatcaaggcgtaccttgacgtcatgctcgcggagcggatcgatatcgagacaatc
gcctcggaattcgccatatcgcgacgtcatctcacccggatcttccgcgaggagaccggc
gaaagcctcaccgattatcagctccggcaacgggtcatgcgcgcgcgttcgctcttgaat
gttcccggcacgaccgtgctgtcggcagccctgagcgtagggatcgaatcgccgtcctac
ctggcaaggctatttaccaagttcggtctgcctgcgccccgcgatctgaaggcatcccgt
gctcgatgcaactga

DBGET integrated database retrieval system