KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6520Help
Entry
Bcen2424_6520     CDS       T00415                                 

Definition
(GenBank) phenazine biosynthesis protein PhzF family
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhzC-PhzF Pro_racemase
Motif
Other DBs
NCBI-ProteinID: ABK13250
JGI: Bcen24246520
Position
3:742770..743642
Genome map
AA seq 290 aa AA seqDB search
MSIVQRVRLVRVFSITDEGGNPAPVVLDANGWSDAQMKEVARAYGLESGFVMRAVDPHHD
FRFRFFVPNHEMEMCGHATLGALWLLRHTGAWRTNTALIETLSGSIEARYDASDARIEVS
QPAGRVEPVVDAALIARTLDALNLDAGDLLPLDIVNATTSRTKTLVPVRTTSRLNAIMPK
LDTIEALCDALSSTGLYPFALDANAPRVFDARQFPRASGYSEDAATGIAAAALLYGAHRH
GLVTGAGRGIVVRQGAAMGRPSAITVNFRDPADASSGCWLSGPVGLMDEA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgtacaacgtgtgcggcttgtacgggtattttccatcaccgacgagggcggc
aatccggccccggttgtgctcgacgcgaacggctggtccgacgcgcaaatgaaagaggtg
gcccgcgcgtatggtctggaaagcgggtttgtgatgcgcgccgtcgatccgcaccatgat
tttcgcttccgcttttttgtgcccaaccacgagatggagatgtgcggacacgcgacgctg
ggcgcattgtggctgctgcgtcacacgggcgcatggcgcacgaacacggcgctgattgaa
acgctgagcggcagcatcgaagcgcggtacgacgcgtccgacgcgcggatcgaagtcagc
cagccggcgggacgcgtcgagccggttgtcgacgcggcgctcattgccaggacactcgat
gcattgaacctcgatgcgggcgacctgctgccgctcgacatcgtcaacgcaacgacgagc
cgcaccaaaacgctggtgccggtccgcacgacctcacggctgaatgcgatcatgccgaaa
ctcgacacaatcgaagcgctatgcgacgcgctgtcgtcgaccggtctgtatccgtttgcg
ctcgatgccaatgcaccgcgcgtgttcgacgcacggcaatttccgcgcgcgtccggctat
tcggaagacgcggcgaccggcatcgcagcggcagcgctcctgtacggcgcgcatcgccat
gggctcgtcaccggagcgggacgcggcatcgtcgtgcgtcagggtgcggcgatgggacgc
ccgtccgcgatcacggtgaactttcgcgatccggccgatgcaagcagcggttgctggctc
agtggcccggttggtctgatggacgaggcctga

DBGET integrated database retrieval system