KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6521Help
Entry
Bcen2424_6521     CDS       T00415                                 

Definition
(GenBank) transcriptional regulator, winged helix family
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C NB-ARC AAA_22 AAA_16 AAA_25 AAA_5 AAA_24
Motif
Other DBs
NCBI-ProteinID: ABK13251
JGI: Bcen24246521
Position
3:743646..745127
Genome map
AA seq 493 aa AA seqDB search
MLLGTLEVDLSTRSLRRDGKAIHVGSRAFDVLAVLLSAAGRLVTKDELMAAVWPGTVVEE
NNLQVHISALRKLLGPQRDLIVTVPGRGYQLTQRSAPSANLTPATPPRQGDSDIPRRHGA
LTGRDSLVSNIAAILDTTHILTLVGAGGVGKTSAAIEVAHAAVSGRFDITRFVALSDAAS
PEAVLQKIATAFGLSIRDDRSAVDALVAALPRDRTLLVLDNAEHVIDAVARLVDSVCMRL
GNLRVLVTSREPLRVSGETVCHVRPLQVPRPESSIAELLDCEAVQMFLQRARQSGCDLDT
LRKSARLVGDICRRLDGNPLAIEMAVGRIGALGVRGVHGFLDDRFKLLTRGYRTALAHHQ
TLQASFDWSFASLSPSSQKLLGHVAAFQRAFTFEALRALVCDARYTLSDVAGDIAELTEK
SLVSVEPGNGEHRFFLSESARAYALQKRRIGGKDIRMFAHYAGYHFSACEEASTIGTDAF
NEKVEERELAYAI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgggcacactcgaagtcgatttgtcgacacgctcgttacgacgtgatgggaag
gctatccatgtcggttcgcgtgcatttgacgtgctcgcggtactgttgtcggcggcgggc
cgtctcgtcacgaaagacgagttgatggccgcggtctggcccggcacggtagtcgaagaa
aacaatctgcaggtccatatttccgcgttgcgaaaattgctcggaccgcaacgcgacctg
attgtgaccgtacccggtcgcggttaccaactgacgcagaggtcagccccgagcgcgaat
ttgacgccggctacaccgcccaggcagggcgacagcgatattccgcgacggcacggggcg
ctcacgggacgcgacagcctagtctccaatattgcggcaatactggacacgacgcatata
ttgacactggtgggcgccgggggagtcgggaaaacgagcgcggcaatcgaagttgctcat
gcggcagtaagcggccgttttgatatcacgcgcttcgtcgcgctttccgatgctgcctct
ccagaagcggtcttgcagaaaatcgcgacggcattcggcctgtcgatacgggacgacagg
tcggcggtggacgcgctagtcgccgctttgccgcgagaccgcacgctgctggtgctggac
aacgccgagcacgtcatcgacgcagtcgctcgactggtcgattcagtttgcatgcggctt
ggcaacttgcgggtactcgtcacgagccgtgagccgttgagggtatcaggtgagactgtc
tgccacgtgcgtccgctccaggtgccgcgtccggagtcatccatcgcagagctgctggat
tgtgaggcagtgcagatgttcttgcagcgcgcgcgacagtcgggttgcgaccttgatact
ttaagaaaaagcgctcgtctcgttggcgatatctgccgtcggctcgacggtaatccactg
gcgatcgaaatggcagtcgggcgtatcggtgcattgggcgttcgaggtgttcacggattt
ctcgacgatcgcttcaagttgctgacgcggggataccggacggcgcttgcgcaccaccag
acgttacaggccagcttcgattggagctttgcgtcgctgagcccgtcgagtcagaagctc
ttgggtcacgttgcggcattccagcgtgcttttacgttcgaggcattgcgtgcgctggta
tgcgatgcgcggtatacgctgtctgacgttgccggcgacattgctgaactgaccgagaag
tcgctggtgagtgtcgagccgggtaacggcgaacatcgattctttctttccgaatccgct
cgagcatacgcgttgcaaaaacgtcgcatcggagggaaggacattcgaatgttcgcgcac
tatgccgggtaccacttcagtgcttgtgaggaagcgtcgaccattggaacggatgcgttc
aacgagaaagtggaagagcgggagcttgcctacgccatctga

DBGET integrated database retrieval system