KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6523Help
Entry
Bcen2424_6523     CDS       T00415                                 

Definition
(GenBank) catechol 1,2-dioxygenase
  KO
K03381  
catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Chlorocyclohexane and chlorobenzene degradation
Benzoate degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen2424_6523
   00364 Fluorobenzoate degradation
    Bcen2424_6523
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bcen2424_6523
   00623 Toluene degradation
    Bcen2424_6523
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     Bcen2424_6523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:745768..746718
Genome map
AA seq 316 aa AA seqDB search
MSVKVFDTTEVQDLLKAASNAAGNRGNGTNGDARTQQIVLRLLGDLFKAIDDLDITPDEV
WAGVNYLNKLGQDSEAALLAAGLGLEKYLDIRMDAADKAIGLDGGTPRTIEGPLYVAGAP
VRDGVAKIDLDADDGAGPLVIQGTVTGLDGKPIAGAVVECWHANSHGFYSHFDPTGKQSD
FNLRGAVRTGADGKYEFRTLMPVGYGCPPQGATQQLLNRLGRHGNRPAHVHFFVDSPAHR
KLTTQFNIDGDPLIWDDFAYATREELIPPVTEKTGGTALGMKADAYQDIEFNFVLTPRVQ
GRDNQIVERLRASATA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaaagttttcgacacgacggaagtgcaggatctgctgaaggccgcatcgaac
gcggccgggaatcgcggaaatggcacgaacggcgacgcacgtacgcagcagatcgtgctg
cgcctgctcggcgacctgttcaaggcgatcgacgatctcgacatcacgcccgacgaagtg
tgggccggcgtgaactacctgaacaaacttggtcaggatagcgaagcggcgctgctcgcg
gccggtctcggtctcgagaaatatctcgacatccggatggacgccgcggacaaggcgatc
ggcctcgacggcggcacgccacgcacgatcgaggggccgctgtacgtggcgggcgccccg
gtgcgcgacggcgtcgcgaagatcgacctcgatgcggacgacggcgcgggcccgctcgtg
atccaaggcacggtcacgggcctggacggcaagccgatcgccggcgcggtggtcgaatgc
tggcatgcgaattcgcacggcttctattcgcatttcgacccgaccggcaagcagagcgac
ttcaatctgcgcggcgcggtgaggaccggcgcggacggcaaatacgaattccgcacgctg
atgccggtcggctacggctgcccgccgcagggcgcgacgcagcaactgctgaatcgcctc
ggccgccacggcaaccgccccgcacacgtgcacttcttcgtcgacagccccgctcaccgc
aagctgacgacgcagttcaacatcgacggagatccgctgatctgggacgacttcgcgtat
gcgacgcgcgaggagctgattccacccgtgaccgaaaagaccggcggcaccgcgctcggc
atgaaggccgacgcgtaccaggacatcgagttcaacttcgtgctgacgccgcgcgtgcag
ggcagggacaaccagatcgtcgaacgcctgcgcgcgtccgccaccgcataa

DBGET integrated database retrieval system