KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6539Help
Entry
Bcen2424_6539     CDS       T00415                                 

Definition
(GenBank) Cytochrome c, monoheme
  KO
K02275  
cytochrome c oxidase subunit II [EC:1.9.3.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Bcen2424_6539
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Bcen2424_6539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:complement(765539..766843)
Genome map
AA seq 434 aa AA seqDB search
MADTPPLSRRSGTRSAQQTACRLPRGRVKMRRSIYKPAVTRRLLCPPSRPLTTAYVRAAR
ARNLLCRERLSSRRRMRQGVVLLVPPFRKTRRITRIAPFAWAAAPIVARAAAEPVAPGNP
AAPLPLAYVVHAAGPAAQPVFVLGWALLALCTFVCVAIAVLLLIALFRRRVQAGGGYGSG
LTIVTVGTAISILLLFGALVYMLRVLGAVAAPPRPPTLTITVTAQDWWWAVRYPDDADGR
GFVTANEIHIPVGQPVAIELKSADVIHAFWVPQLAGKTQTIPGQTNRQWLQADRPGVYRG
QCSQYCGAQHAHMAFEVVAEPPAAFHAWLAAQRQPAPAPAAGAGAERRGQRVFAARCAGC
HAVRGTDAAGDAGPDLTHVGTRRLLAAGTLDNTPDNLRRWIAHAQQVKPQSLMPSIALAP
RDADDLAAYLATLH
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgccgccgctgtcgcgtcgttccggaactcgatcggcacagcaaacggcc
tgccgcttgccacgcgggcgcgtaaaaatgcgccgctcgatttacaagccggctgtaacg
cgccggctgttgtgcccgccgtcccgccccctcacgaccgcatacgtacgagcggcgcgc
gcacgaaatttgctctgccgcgaacggctgtcgtcacgccgccgaatgcggcaaggagtc
gtgttgctcgttccgccgttcaggaaaacgcgtcgtattacacgcatcgcaccgttcgcg
tgggcggccgcgccgatcgtcgcgcgcgcggccgccgagcccgtggcgcccggcaatcct
gccgcgccgctgccgctcgcgtacgtcgtgcatgcggccggccccgccgcgcagccggtc
ttcgtgctcggctgggcgctgctcgcgctgtgcacgttcgtgtgcgtcgcgatcgccgtg
ctgctgctgatcgcgctgtttcgccgccgcgtgcaggcgggcggcggctatggcagcggg
ctgacgatcgtgaccgtcggcaccgcgatctcgatcctgctgctgttcggcgcgctcgtg
tacatgctgcgcgtgctgggtgcggtcgcggcgccgccgcgtccgcccacgctgacgatc
accgtgaccgcgcaggactggtggtgggccgtgcgttatcccgacgatgcggacggccgg
ggcttcgtcacggcgaacgagattcatattccggtgggccaacccgtcgcgatcgaactg
aagagcgccgacgtgatccacgcgttctgggtgccgcaactcgccggcaagacccagacg
attcccggccagaccaatcgtcaatggctgcaggcagaccggcctggcgtctaccgcggc
cagtgctcgcaatactgcggcgcgcagcatgcgcacatggcgttcgaagtcgtggccgag
ccgccggccgcgtttcatgcgtggctcgccgcgcagcgccaaccggccccggcacccgcg
gcaggcgccggggccgaacgccgcggccagcgcgtattcgccgcacgctgcgccggctgc
cacgcggtgcgcggcaccgatgccgcaggcgacgcgggccccgatctcacgcacgtcggc
acgcgccggctgctcgcggccggcacgctcgacaacacccccgacaacctgcgccgctgg
atcgcgcatgcgcagcaggtcaagccgcagtcgctgatgccgtcgatcgcgctcgcgccg
cgcgatgccgacgatctcgccgcgtatctcgcgacgctgcactga

DBGET integrated database retrieval system