KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6543Help
Entry
Bcen2424_6543     CDS       T00415                                 

Definition
(GenBank) protein of unknown function DUF1452
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iron_permease DUF3810
Motif
Other DBs
NCBI-ProteinID: ABK13273
JGI: Bcen24246543
Position
3:770465..770971
Genome map
AA seq 168 aa AA seqDB search
MREPNEPPRGRRDTACGPAAGSRPAGNAVTRAFERFASSVTTWAGSPVAFGSAVAITVLW
LVSGPLFHYSNAWQLVINTGTTIITFLMVFLLQRNQNRDSVALHLKLDELLAVTRAASDR
LIGIEDASEEELRALAQTYVEMAQRAAERGEDEPGGKRAETADTPPES
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaacccaacgaaccaccgcgcggtcgtcgcgacacggcgtgcgggcccgccgcc
ggttcccggccggccggaaacgccgtcacccgcgcgttcgaacgttttgcgtcgagcgtg
accacctgggccggctcgccggtggcgttcggcagcgcggtcgcgatcaccgtgctgtgg
ctcgtgagcgggccgctgtttcattactccaacgcgtggcagctcgtgatcaacaccggc
accacgatcatcacgttcctgatggtgttcctgctgcagcgcaaccagaaccgcgacagc
gtggcgttgcacctgaagctcgacgaactgctcgcggtcacgcgcgcggcgagcgaccgg
ctgatcgggatcgaggatgcgtcggaggaggaattgcgcgcgttggcgcagacctatgtc
gaaatggcgcagcgcgcggccgagcgcggcgaggacgaaccgggcggcaagcgcgcggaa
acggccgacacgccgcccgaatcctga

DBGET integrated database retrieval system