KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6547Help
Entry
Bcen2424_6547     CDS       T00415                                 

Definition
(GenBank) hypothetical protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABK13277
JGI: Bcen24246547
Position
3:772805..773152
Genome map
AA seq 115 aa AA seqDB search
MSFLPPAIEGGPCGATYELSRVVRFVGPMRRPAFRLGRLAFGGVVGAARRRRARAAALAF
GAGRAVAAIFAACIGVERGGACHGSRVLSGAVVMHASRIVHAAVGRSRWPGPPFA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
ttgtcatttctgccgccggccatcgagggcgggccgtgcggcgcgacgtatgaactatcg
cgagtcgtccggttcgtcgggccgatgcggcgtcccgctttccggctcggtcggcttgcc
ttcggcggggtcgtgggcgctgcgcggcggcggcgtgcccgtgccgcggcgcttgccttc
ggggccgggcgtgctgtcgccgcgatcttcgccgcgtgtatcggtgtcgagcgaggtgga
gcgtgccatggttcgcgagtcctgtcgggggcggtcgtaatgcacgcgtcgcgcatcgtg
catgccgcggtcggacgaagcaggtggccgggcccgccgtttgcttga

DBGET integrated database retrieval system