KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6549Help
Entry
Bcen2424_6549     CDS       T00415                                 

Definition
(GenBank) drug resistance transporter, EmrB/QacA subfamily
  KO
K03446  
MFS transporter, DHA2 family, multidrug resistance protein
Organism
bch  Burkholderia cenocepacia HI2424
Brite
Transporters [BR:bch02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    Bcen2424_6549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:774726..776318
Genome map
AA seq 530 aa AA seqDB search
MSRPPERGGASGGTWRPAANPWLIAIVVTLAAFMEVLDTTIVNVALPHIAGTMSASYDEA
TWTLTSYLVANGIVLPISGFLGRLLGRKRYFLLCIAAFTVCSFLCGVATNLGELIVFRVL
QGLFGGGLQPNQQSIILDTFPPEQRNRAFSISAIAIVVAPVLGPTLGGWITDHFSWRWVF
LLNVPIGALTVLAVMQLVEDPPWRRDAERGISIDYIGIGLIAIGLGCLQVMLDRGEDEDW
FGSNFIRVFAVLSVLGLVGATLWLLRTKKPVVDLSCLRDRNFALGCVTIATFAAVLYGSA
VIVPQLAQQRLGYTATLAGLVLSPGALLITLEIPLVSRLMPHVQTRYLVGFGFVLLCASL
IYSRTLVPDIDYTHLMLIRCAQSLAIGFMFVPITTLAYLTVPQRLNDDASALFTMFRNVA
GSIGISVSTALIRERTQARMAHLSTHMSTLSQNFQDALQENARAIGALTGAQPSAALQTA
SGRLYQTFIEQATILAYIDVFAILAVFCAFSIPLTFLFSPAKAAGGAGGH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagccggccgcccgagcgcggcggcgcgtccggcggcacctggcgacccgccgcgaat
ccgtggctcatcgcgatcgtcgtcacgctcgccgcgttcatggaagtgctcgacacgacg
atcgtcaacgtcgcgctgccgcacatcgccggcacgatgtcggcgagctacgacgaggcg
acctggacactcacgtcgtatctcgtcgcgaacggcatcgtgctgccgatttcggggttc
ctcgggcgcctgcttggccgcaagcgctacttcctgctgtgcatcgccgcgtttaccgtg
tgctcgttcctgtgcggcgtcgcgaccaacctcggcgaactgatcgtgttccgcgtgctg
caagggctgttcggcggcgggctgcagccgaaccagcagtcgatcatcctcgatacgttt
ccgcccgagcagcgcaatcgcgcgttctcgatctcggcgatcgcgatcgtcgtcgcgccg
gtgctcgggccgacgctcggcggctggatcaccgaccatttctcgtggcgctgggtgttc
ctgctcaacgtgccgatcggcgcgctgaccgtgctcgcggtgatgcagctcgtcgaggac
ccgccgtggcggcgcgacgccgaacgcggaatctcgatcgactacatcggcatcgggctg
atcgcgatcgggctcggctgcctgcaggtgatgctcgatcgcggcgaggacgaggactgg
ttcggctcgaacttcatccgcgtcttcgccgtgctgtccgtgctcgggctggtcggcgcg
acgctgtggctgctgcgtacgaagaaaccggtggtcgacctgtcgtgcctgcgcgaccgc
aatttcgcgctcggctgcgtgacgatcgcgacgttcgcggccgtgctgtacggcagcgcg
gtgatcgtgccgcagctcgcgcagcagcgtctcggctacacggcgacgctcgcggggctc
gtgctgtcgcccggcgcgctgctgatcacgctcgagattccgctcgtgagccggctgatg
ccgcacgtgcagacgcgctatctggtcgggttcggcttcgtgctgctgtgcgcttcgctg
atctattcgcgcacgctggtgccggacatcgactacacgcacctgatgttgatccgctgc
gcgcagtcgctcgcgatcggcttcatgttcgtgccgatcacgacgctcgcgtacctgacc
gtgccgcagcggctcaacgacgacgcgtccgcgctgttcacgatgttccgcaacgtcgcg
ggctcgatcggcatctcggtgtcgaccgcgctgatccgcgagcgcacgcaggcgcgcatg
gcgcatctgtccacgcacatgtcgacgctgtcgcagaacttccaggatgcgttgcaggag
aatgcgcgcgcgatcggcgcgctgacgggcgcgcagccgtcggccgcgctgcagacggcg
agcgggcggctgtaccagaccttcatcgaacaggcgacgatcctcgcgtatatcgacgtg
ttcgcgatcctcgcggtgttctgcgcgttcagcattccgctgacgttcctgttctcgccg
gcgaaggccgcgggcggcgcgggagggcattga

DBGET integrated database retrieval system