KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6556Help
Entry
Bcen2424_6556     CDS       T00415                                 

Definition
(GenBank) alkylphosphonate utilization operon protein PhnA
  KO
K06193  
protein PhnA
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Microbial metabolism in diverse environments
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:781591..781944
Genome map
AA seq 117 aa AA seqDB search
MEAAMNAPACPQCAMENTYPDGALTVCADCGHEWSADAGAEAGDEPAGDVVKDANGNVLS
DGDSVVLIKDLRVKGSSITLKMGTKVKSIRLVGGDHEVDCKTDMGGFMLKACYLKKV
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcaatgaatgcccccgcctgcccgcaatgcgcgatggaaaacacttacccg
gatggcgcactgaccgtgtgcgcggactgcggccatgaatggtcggccgacgccggcgcc
gaggccggcgacgaaccggcgggcgacgtcgtcaaggacgccaacggcaacgtgctgtcg
gacggcgattcggtcgtgctgatcaaggacctgcgcgtgaagggttcgtcgatcacgctg
aaaatgggcaccaaggtcaagagcatccggctcgtcggcggcgatcatgaagtcgactgc
aagaccgacatgggcggcttcatgctgaaggcgtgctatctgaagaaggtctga

DBGET integrated database retrieval system