KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6557Help
Entry
Bcen2424_6557     CDS       T00415                                 

Definition
(GenBank) spermidine synthase-like protein
  KO
K00797  
spermidine synthase [EC:2.5.1.16]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
beta-Alanine metabolism
Glutathione metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bcen2424_6557
   00330 Arginine and proline metabolism
    Bcen2424_6557
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcen2424_6557
   00480 Glutathione metabolism
    Bcen2424_6557
Enzymes [BR:bch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     Bcen2424_6557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:782012..782848
Genome map
AA seq 278 aa AA seqDB search
MAEDRTSYDAFVRFLATPLNDGRPFVLETQHAVSLHFDHFGTQSFMSLRDPVRLALGYTR
VMMGFLLLQAEPAHICMLGLGGGSLAKYCYRHLPGTTLDAVEINPDVIALRDVFRIPADD
ARFRVVCADGADHLERADVRTDVILHDAFVADGRRGRCTGGTFLDMCRARLSESGVLAIN
FMDDDPALPEHLEQLRSVFGSSYALVPCGDDNNFVAFAWKDGSRLPSLRILLERTLACPQ
AGELKLAATARRMKHGEGIDPRRLVWRAQSHERWEIGA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatcgaacttcctacgacgcgttcgtcaggttcctggcgacgccgctgaac
gacggccggccgttcgtgctggagacgcagcacgcggtctcgctgcacttcgatcatttc
ggcacccagagcttcatgtcgctgcgcgatccggtgcggctcgcgctcggctatacgcgc
gtgatgatgggtttcctgctgttgcaggccgagccggcgcacatctgcatgctcgggctc
ggcggcgggtcgctcgcgaagtactgctaccgccacttgccgggcacgacgctcgacgcg
gtcgagatcaatccggacgtgatcgcgctgcgcgacgtgttcaggattcctgccgatgat
gcgcgctttcgcgtggtatgcgcggacggcgcggatcatctcgagcgggcggacgtccgg
acggacgtgatcctgcacgacgcgttcgtcgccgacgggaggcgcgggcgctgtacgggc
ggcacatttctcgatatgtgccgcgcgcgcctgagcgaatccggcgtgctcgcgatcaac
ttcatggacgacgatcccgccttgccggagcacctcgagcaactgcgatcggtattcggt
tcgtcgtatgcgctggtgccgtgtggcgacgacaacaacttcgttgcattcgcgtggaag
gacggcagccggctgccgtcgttgcgtatcctgctggagcggacgctcgcctgcccgcag
gccggcgaactgaagctcgctgccaccgcgcggcgcatgaagcacggcgagggcatcgat
ccgcggcggctggtgtggcgtgcgcaatcgcacgaacgttgggagatcggcgcgtaa

DBGET integrated database retrieval system