KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6562Help
Entry
Bcen2424_6562     CDS       T00415                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02031  
peptide/nickel transport system ATP-binding protein
K02032  
peptide/nickel transport system ATP-binding protein
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:bch00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Bcen2424_6562
Transporters [BR:bch02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Bcen2424_6562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:complement(784879..786558)
Genome map
AA seq 559 aa AA seqDB search
MSTPDTVARATTSSAAPLARIERLTIGFRGPRGTQAVVGPLDLAVHAGECVALVGESGSG
KSVTARSLVGLNGPHAVIDAARFEIAGIDARGHRERDWRAIRGRRIGYVLQDALVSLDPL
WRVRDLVAEALHDTRRRDVAARSADLLRSVGIDDPERRLPQYPHQLSGGLRQRVLIGTAI
AGGASLLIADEPTTALDMTVQRQILSLLRARRDAGDAILLISHDLAVVAELADRVLVMRA
GQVVEQGSARDVLSAPTHPYTRALLAAIPTAASRGFRLATAERVPLPPKRIDAQAPVLAV
DALTKRYGGRDAPPAVDGVSFSLARGETLGIVGESGSGKSTVARIVLGLVEPDAGTVTLD
GQPWNGIPEAARRTRRARLQLIAQDPYSSFDPRYSVGRIIGEGLEVVGLHGDARRRRVLQ
LLDEVQLGAACLDRYPRELSGGQRQRVAIARAFASNPALLVADEPVSALDVSIQAQVLDL
LADLQAEHGTAMLFISHDLGVVHHVADRILVMRRGRVVESGPVTQVFDAPSHPYTASLLD
ALPTLPGGTATAPTLTALA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcccgataccgttgcgcgcgcaacgacatcttccgccgcgccgctggcccgc
atcgagcgcctgacgatcgggtttcgcggcccgcgaggaacacaggccgtcgtcggcccg
ctcgaccttgccgtgcatgccggcgaatgcgtcgcgctcgtcggcgaatcgggttccggc
aagtcggtcaccgcgcgcagtctcgtcgggctgaacggcccgcacgcggtgatcgatgcc
gcccggttcgagatcgccggcatcgatgcgcgcggccatcgcgagcgcgactggcgcgcg
atacgcggccgccggatcggctacgtgctgcaggacgcgctggtgtcgctcgacccgctg
tggcgcgtgcgcgacctcgtcgcggaggcgttgcacgatacgcgtcggcgcgatgtcgcc
gcgcgcagcgccgacctgctgcgctcggtcggcatcgacgatcccgagcggcggctgccg
cagtatccgcatcagttgtcgggcggcttgcggcagcgcgtactgatcggcaccgcgatc
gcgggcggcgcgtcgctgctgatcgccgacgagccgaccacggcgctggacatgaccgtg
caacgccagatcctgtcactgctgcgtgcgcgccgggacgccggcgacgcgatcctgctg
atcagccacgacctcgcggtcgtcgcggagctggccgaccgcgtgctggtgatgcgcgcg
ggccaggtcgtcgaacaggggtcggcacgcgacgtgctgagcgcaccgacgcatccgtac
acgcgtgcgttgctcgcggcgattcccaccgccgcgtcgcgcgggttccggctggcgacc
gccgagcgcgtgccgctgccgccgaagcgcatcgacgcgcaggcaccggtgctggccgtc
gacgcgctgacgaagcgctacggcggacgcgatgcgccgcccgccgtcgacggcgtgtcg
ttctcgctcgcgcgcggcgagacgctcggcatcgtcggtgaatccggttccggcaaatcg
acggtcgcgcggatcgtgctcgggctcgtcgaacccgacgccggcaccgtcacgctcgac
ggccagccatggaacggcatccccgaagccgcgcggcgcacccgccgtgcgcggctgcag
ctgatcgcccaggacccgtacagttcgttcgatccgcgctattcggtcggccggatcatc
ggcgaagggctcgaggtggtcggactccacggcgacgcgcgccgccgccgcgtgctgcaa
ctgctcgacgaagtgcagctcggtgcggcgtgcctcgaccgttatccgcgcgaattgtcc
ggtggccagcgccagcgcgtcgcgatcgcgcgcgcgttcgcgtccaacccggcactgctc
gtcgcggacgaaccggtcagcgcgctcgacgtgtcgatccaggcgcaagtgctcgacctg
ctcgccgatctgcaggccgaacacggcaccgcgatgctgttcatctcgcatgacctgggt
gtggtgcatcacgtggccgaccggattctcgtgatgcgacgcggccgcgtggtcgaaagc
gggccggtcacgcaggtattcgacgcgccgtcgcacccgtataccgcgtcgcttctcgac
gcactgcccacgctgcccggcggcacggctaccgcgccgacgctcaccgcgctcgcatga

DBGET integrated database retrieval system