KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6564Help
Entry
Bcen2424_6564     CDS       T00415                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02033  peptide/nickel transport system permease protein
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch02024  Quorum sensing
Module
bch_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:bch00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Bcen2424_6564
Transporters [BR:bch02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Bcen2424_6564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABK13294
JGI: Bcen24246564
Position
3:complement(787438..788448)
Genome map
AA seq 336 aa AA seqDB search
MNRPSSAFVSVPDARPAAAPPAAWRRWLRSPIATRLATGALVLWAAVTLSFAAVHLAPGD
IVSILIGEQLSTPEIEAAIRQEWGLDEPLALQYVHYLWRVLHGEFGRSYILNTDVAPLVL
GQLWPTLKLTGAALVVTIVFAVGLAVLTAGRRWAGRAASGVELLLASTPSFWLGIMLLFV
FSFTLKLFPVAGDRGFASLVLPALSLGLAQGAVIGRVLRQGIERALDEPYALTVRSWGIG
GLALRVRHALRHAALPAVTLAGWLVGGLLSGAVITEQVFGRPGLGKVTVDAVLSKDMPVI
LAIAILSAAIYVTLSTAVDLLYLLIDPRLRDRRAAR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtccgtcgtccgctttcgtctccgtcccggacgcgcggcctgccgctgcgccg
ccggccgcatggcgccgctggctgcgttcgccgatcgcgacgcggctcgccaccggcgcg
ctcgtgctgtgggccgcggtcacgctgtcgttcgccgccgtgcatctcgcgccgggcgac
atcgtcagcatcctgatcggcgagcagttgagcacgccggagatcgaagccgcgatccgc
caggaatgggggctcgacgaaccgctcgcgctgcaatacgtgcattacctgtggcgcgtg
ctgcacggcgagttcggccgctcgtacatcctgaacaccgacgtcgcgccgctcgtgctc
ggccagctgtggccgacgctgaaactgacgggcgcggcgctggtcgtgacgatcgtgttc
gcggtcggcctcgcggtgctgaccgccggccgccgctgggccggccgcgcggcatcgggc
gtcgagctgttgctcgcatcgacgccgtcgttctggctcggcatcatgctgctgttcgta
ttcagcttcacgctgaagctgttcccggtggccggcgatcgcggcttcgcgtcgctcgtc
ctgcccgcgctgtcgctcgggctcgcgcagggggcggtgatcggccgcgtgctgcggcaa
ggcatcgagcgcgcgctcgacgagccgtacgcgctgacggtgcgttcgtggggcatcggc
ggactcgcgctgcgcgtgcgccatgcgctgcgccacgcggcgctgccggccgtcacgctc
gccggctggctcgtcggcggcctgctgagcggcgcggtgatcaccgaacaggtgttcggc
cggcccggcctcggcaaggtgacggtcgacgcggtgctatcgaaggacatgccggtgatc
ctcgcgatcgcgatcctgtcggcggccatctacgtcacgctcagcacggccgtcgacctg
ctgtacctgctgatcgatccccgcctgcgcgaccgccgcgcagcgcgttga

DBGET integrated database retrieval system