KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6571Help
Entry
Bcen2424_6571     CDS       T00415                                 

Definition
(GenBank) amino acid ABC transporter membrane protein 1, PAAT family
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:794595..795329
Genome map
AA seq 244 aa AA seqDB search
MAADDSLLALLAFGDGGYGRVFAGAFALTFGVAAASFCTGVLLGIAGALGKLSRYAAFVW
LARLYTMLVRALPELLCLLLAFYAVAPAIENALHGSGIVSGDFAFDPFVVAALSLGFIQG
AYLTDIFRAALANVPVGQIEAAHAYGMTPWQTFTRIRLPAAARLALPGVGNVWLNATKDA
SFISVLGSFTDLLKASQLAAGATRHYVFFYLVTAALFLLLSITSTGIFAALERHANRGTR
RATT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggacgattcgctgctcgcgttgctcgccttcggcgacggcggttatggccgc
gtgttcgcgggtgcgttcgcgctgacgttcggcgtcgcggccgcgtcgttctgcaccggc
gtgctgctcggcatcgccggcgcgctcggcaagctgtcgcgatacgcggcgttcgtgtgg
ctggcgcggctctacacgatgctcgtgcgcgcgctgccggagttgttgtgcctgctgctc
gcgttctacgcggtcgcaccggccatcgagaacgcgctgcacggcagcggcatcgtttcc
ggcgacttcgcgttcgacccgttcgtcgtcgccgcgctatcgctcggtttcatccagggc
gcgtatctcaccgacatcttccgcgcggcgctcgccaacgtgccggtcggccagatcgaa
gccgcgcacgcgtacgggatgacgccctggcagacgttcacgcgcatccggctcccggcc
gcggcgcggctcgcgctgccgggcgtcggcaacgtgtggctgaacgcgaccaaggacgcg
tcgttcatcagcgtgctcggatcgttcacggatctgctgaaggcgagccagctcgcggcc
ggtgcgacgcggcactacgtattcttctatctggtcacggccgcgctgttcctgctgctg
agcatcacgtcgaccggcattttcgcggcgctggagcggcatgcgaatcgcggcacgagg
cgcgcgacgacatga

DBGET integrated database retrieval system