KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6572Help
Entry
Bcen2424_6572     CDS       T00415                                 

Definition
(GenBank) amino acid ABC transporter membrane protein 2, PAAT family
  KO
K02029  polar amino acid transport system permease protein
Organism
bch  Burkholderia cenocepacia HI2424
Module
bch_M00236  Putative polar amino acid transport system
Brite
Transporters [BR:bch02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Bcen2424_6572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABK13302
JGI: Bcen24246572
Position
3:795428..796093
Genome map
AA seq 221 aa AA seqDB search
MLLGVPLALAAGARHTPLRWSARGWLMLIRGTPLLVQLYLLYYGFGQIVPREWMRDSWAS
PLLRDAFWYAIVALSVNESAYVATILRGAIAGVPAGEIEAGHAYGMTRTQVLRRIVGPRA
WRLALPALTGEAILLLKSTVLASTVTVFDVMGTANTLRFETLRVYEPLAGAAIVYVVLVA
LLTIPAARLEQRINRYLTRQPDERVPARRRRASSGAWAAPN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctgggcgtgccgctcgcgctcgccgccggtgcgcgccatacgccgctgcgctgg
tccgcgcgcggctggctgatgctgatccgcggcacgccgctgctcgttcagctttatctg
ctgtactacggattcgggcagatcgtgccgcgcgaatggatgcgcgacagctgggcgtcg
ccgctgctgcgcgacgcgttctggtacgcgatcgtcgcgctgagcgtgaacgagagcgcg
tacgtcgcgacgatcctgcgcggcgcgatcgccggcgtgccggccggcgagatcgaggcc
ggccacgcctacgggatgacgcgcacgcaggtgctgcgccgcatcgtcggcccgcgtgcg
tggcggcttgcgctgcccgcgctcaccggcgaggccatcctgctgctgaaatcgaccgtc
ctcgcgtcgaccgtgaccgtattcgacgtgatgggcacggccaatacgctgcgcttcgag
acgttgcgcgtgtacgaaccgctggccggtgcggcgatcgtctatgtcgtgctggtcgcg
ctgctgaccattcccgccgcccgtctcgagcagcgcatcaatcgctacctgacgcgccag
cccgacgaacgcgtgcctgcccggcgccgccgcgcgtcgtcgggcgcgtgggcggcaccc
aactga

DBGET integrated database retrieval system