KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6572Help
Entry
Bcen2424_6572     CDS       T00415                                 

Definition
(GenBank) amino acid ABC transporter membrane protein 2, PAAT family
  KO
K02029  
polar amino acid transport system permease protein
Organism
bch  Burkholderia cenocepacia HI2424
Module
Putative polar amino acid transport system
Brite
Transporters [BR:bch02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Bcen2424_6572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:795428..796093
Genome map
AA seq 221 aa AA seqDB search
MLLGVPLALAAGARHTPLRWSARGWLMLIRGTPLLVQLYLLYYGFGQIVPREWMRDSWAS
PLLRDAFWYAIVALSVNESAYVATILRGAIAGVPAGEIEAGHAYGMTRTQVLRRIVGPRA
WRLALPALTGEAILLLKSTVLASTVTVFDVMGTANTLRFETLRVYEPLAGAAIVYVVLVA
LLTIPAARLEQRINRYLTRQPDERVPARRRRASSGAWAAPN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctgggcgtgccgctcgcgctcgccgccggtgcgcgccatacgccgctgcgctgg
tccgcgcgcggctggctgatgctgatccgcggcacgccgctgctcgttcagctttatctg
ctgtactacggattcgggcagatcgtgccgcgcgaatggatgcgcgacagctgggcgtcg
ccgctgctgcgcgacgcgttctggtacgcgatcgtcgcgctgagcgtgaacgagagcgcg
tacgtcgcgacgatcctgcgcggcgcgatcgccggcgtgccggccggcgagatcgaggcc
ggccacgcctacgggatgacgcgcacgcaggtgctgcgccgcatcgtcggcccgcgtgcg
tggcggcttgcgctgcccgcgctcaccggcgaggccatcctgctgctgaaatcgaccgtc
ctcgcgtcgaccgtgaccgtattcgacgtgatgggcacggccaatacgctgcgcttcgag
acgttgcgcgtgtacgaaccgctggccggtgcggcgatcgtctatgtcgtgctggtcgcg
ctgctgaccattcccgccgcccgtctcgagcagcgcatcaatcgctacctgacgcgccag
cccgacgaacgcgtgcctgcccggcgccgccgcgcgtcgtcgggcgcgtgggcggcaccc
aactga

DBGET integrated database retrieval system