KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6574Help
Entry
Bcen2424_6574     CDS       T00415                                 

Definition
(GenBank) monosaccharide ABC transporter ATP-binding protein, CUT2 family
  KO
K02056  
simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
bch  Burkholderia cenocepacia HI2424
Module
Putative simple sugar transport system
Brite
Enzymes [BR:bch01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     Bcen2424_6574
Transporters [BR:bch02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    Bcen2424_6574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:797605..799167
Genome map
AA seq 520 aa AA seqDB search
MNSATNETMEATRREARPHRSASPPVLSVTGIAKRFDATVALAALDLSIGAGEVVALMGA
NGAGKSTFVKILSGALQADGGTLTLRGEPYRPASPHAAKRLGVATVHQSVADAVVPTLSI
ADNLLLDRLCDPASPWRAPPAARRAAARSLAARVGLDADLAAPLASLSLADQQRVTLARA
LAGQPSLLILDEPTASLSAAEAERLFELVDALRRDGVAILLVSHRLGDLRRIADRAAIVR
DGRIVADLAAPIDFDAAVETMIGRPLPRTRAVAPERVAPAESGPGSGFSVRQIRLTPTST
PFDLDVRRGEIVAIAGPVGGGKSRFARTIFGAVRAAGGEMTLDGRPWRPRTPADAIRAGV
FLAGEDRWRTSLFPDSVPFASIAGTIGFPFLARWFVSGAVRRTRERTAAAAAIARFGIRC
EGPDDRVAHLSGGNQQKVVLARWHAEPARLLLLDEPFQGIDAGARADIVDTLRRHAHERT
TIVFVSDLEEAAEIADRIVRFDRATLDGLSPTSSIVGACS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcgcgacgaacgaaaccatggaggcgacgcggcgcgaagctcgaccccatcga
tcggcatcgccgcccgtcctgagcgtcacgggcatcgcgaaacgcttcgacgcgaccgtc
gcgctggcggcgctcgacctgtcgatcggcgccggcgaagtcgtcgcgctgatgggcgcg
aacggcgcgggcaagtcgactttcgtcaagatcctgagcggcgcgctgcaagcggacggc
ggcacgctgacgctgcgcggcgaaccatatcggccggcgtcgccgcacgcggccaagcgg
ctcggcgtcgcgaccgtgcaccagtcggtggctgacgccgtcgtgccgacgctgtcgatc
gccgacaacctgctgctcgaccggctgtgcgacccggcgtcgccgtggcgcgcgccgccg
gccgcgcggcgtgccgcggcgcgttcgcttgccgcacgggtcgggctcgacgccgatctg
gcggcgccgctcgcatcgctgtcgctggccgaccagcagcgcgtgactctggcccgtgcg
ctggccggccagccgtcgttgctgatcctcgacgagccgaccgccagcctgtcggcggcg
gaggccgagcggctgttcgagctggtggacgcgttgcgccgcgatggcgtcgccatcctg
ctggtgtcgcatcggctcggcgacttgcgtcgtatcgcggatcgcgcggcgatcgtccgc
gatggccggatcgtcgcggatctggccgcgccgatcgatttcgacgccgcggtggaaacg
atgatcggccggccgttgccgcgtacgcgtgccgtggcgccggagcgggtcgcaccggcc
gaatccgggcccggatcaggcttcagcgtgcggcagatccggctgacgccgaccagcacg
ccgttcgacctcgatgtccggcgcggcgagatcgtcgcgatcgcgggcccggtcggcggc
ggcaagtcgcgcttcgcgcggacgatcttcggcgcggtgcgggcggccggcggcgagatg
acgctcgacggacggccatggcggccacgaacgcccgccgatgcgattcgcgccggcgta
ttcctggccggcgaggatcgctggcgcacgtcgctgtttcccgacagcgtcccgttcgcg
tcgatcgccggcaccatcggctttccatttctggcgcgctggttcgtgagcggtgcggtg
cgccgaacgcgcgaacgcacggcggccgccgcggcgatcgcgcggttcgggattcgctgc
gaggggccggacgatcgcgtcgcgcacctgtccggcggcaaccagcagaaggtcgtgctc
gcgcgctggcacgccgagccggcgcggctgttgctgctcgacgaaccgttccagggcatc
gatgcgggcgcgcgcgccgatatcgtcgatacgctgcggcgtcatgcgcatgagcgcacg
acgatcgtattcgtcagcgatctcgaggaagctgccgagatcgccgatcgtatcgtgcgg
ttcgatcgcgcgacgctcgatggcctgtctccgacttcctccatcgtgggtgcctgctca
tga

DBGET integrated database retrieval system