KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6577Help
Entry
Bcen2424_6577     CDS       T00415                                 

Definition
(GenBank) OsmC family protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OsmC
Motif
Other DBs
NCBI-ProteinID: ABK13307
JGI: Bcen24246577
Position
3:801523..802053
Genome map
AA seq 176 aa AA seqDB search
MTTLNDYLAQKRDAWHAKQQAARNDPDFKATPLKATVRALGRSGVREIRIRDFQVISDSP
PDFAGYNLGPASPELQLGVLGSCLTHITLIQAAERGLKIDAIEVEVTGDQHPLAQQPGFE
HVPVFPHNLRYTLDIVSPEPPEAIRALHQAVEEVCPIFNLLRLPQHIDGELRHTSA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctgaacgactatctcgcgcaaaagcgcgatgcgtggcatgcgaagcagcag
gccgcccgcaacgatcccgatttcaaggcgacgccgctgaaggcgaccgtgcgcgcgctc
ggtcgcagcggcgtgcgcgagatccggattcgcgatttccaggtgatcagcgacagcccg
cccgatttcgcgggctacaacctcgggcccgcatcgccggaactgcaactcggcgtgctc
ggcagttgcctcacgcacatcacgttgatccaggccgcggagcgggggctgaagatcgac
gcgatcgaagtcgaagtcaccggcgatcagcatccgctcgcgcagcagccgggattcgag
catgtgccggtattcccgcacaacctccgctatacgctggacatcgtgtcgccggagccg
ccggaggcgatccgtgcattgcatcaggcggtggaggaggtgtgcccgatcttcaacctg
ctgaggctgccgcagcacatcgacggggaattgcggcataccagcgcgtga

DBGET integrated database retrieval system