KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6578Help
Entry
Bcen2424_6578     CDS       T00415                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:complement(802197..803123)
Genome map
AA seq 308 aa AA seqDB search
MRVDPLSEVLSLLETRDSFFTGLRAGGPWAVDLPPPDGIKFNAVVEGSCWLTVDGAGPPV
RLRTGDCFLLAAPRAFSLASDPSVAPVPAADVYRHLERGIAHYGEPADCFLIGGRFAYEE
RMPLLLGSLPPVVIVSGDSEPAAVLRWSLQQLAREFGASSPGGSLMVRHLGHMMLVQILR
RYVDAGANGDVGWLAGFADARVSAALAAIHAAPERRWTVDALAACCHVSRSTFALHFKQR
LGFGPLEYVLRWRIQLAMRELRRSNASISAIAQRLGYDSDSAFGHAFKRIVGCSPRAYRH
DVTKEPGN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggacccgctttcggaagtgctgtcgctgctggaaacgcgcgactcgtttttc
accggcctgcgcgccggcggcccgtgggcggtcgaccttcccccgcccgacggaatcaag
ttcaacgcggtagtcgaagggagttgctggctgaccgtcgacggtgcggggccgcccgtc
cggctgcgcacgggagactgcttcctgctcgccgcgccgcgggcattttcgctggcgagc
gatccgtcggtcgcgccggtgccggccgccgacgtgtaccggcatctcgagcgcggtatc
gcgcactacggcgagccagccgactgctttctgatcggcggccgcttcgcgtacgaggaa
cgcatgccgctgctgctcggcagcctgccgcccgtggtgatcgtgagcggcgattccgaa
ccggcggcggtgctgcgctggtcgctgcagcagctcgcacgggaattcggcgcgtcgtcg
ccgggcgggtcgctgatggttcgacatctcggacacatgatgctggtgcagatcctgcgg
cgctacgtggacgccggcgcgaacggcgatgtcgggtggctggcggggttcgcggatgcg
cgggtcagcgcggcgctggccgcgattcacgcggcgcccgagcggcgctggaccgtcgat
gcactggcggcctgctgccacgtgtcgcgttcgacgttcgcgctgcatttcaagcagcga
ctggggttcgggccgctcgaatacgtgctgcggtggcggatacagctggcgatgcgcgaa
ctgcgccgctcgaacgcgtcgatctcggcgatcgcgcagcggctcggctacgactcggat
agtgcgttcggccatgcgttcaaacgcatcgtgggctgctcgccgcgcgcctatcgtcat
gacgtgacgaaggaacccggcaactag

DBGET integrated database retrieval system