KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6583Help
Entry
Bcen2424_6583     CDS       T00415                                 

Definition
(GenBank) CBS domain containing protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-ProteinID: ABK13313
JGI: Bcen24246583
Position
3:807162..807587
Genome map
AA seq 141 aa AA seqDB search
MTCVSEVMTRDAATIGPTQSLREAARLMSDLNVGALPVCDGTRLIGMLTDRDIVVRAVSM
GVPPDEAVEGVVSGPANWCYEDDDISAVQKKMENAQIRRVPVVDRQKRLVGIVALGDLAT
AADGAMSSTLGAVSAPSRPDR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgacatgtgtatcggaagtgatgacacgcgacgccgcgaccatcggcccgacgcagagc
ctgcgcgaggcggcccggttgatgagcgacctgaacgtcggtgcgctgcccgtatgcgac
ggcacgcgcctgatcggcatgctgacggaccgggacatcgtcgtgcgcgcggtgtcgatg
ggcgtgccgccggacgaggcggtggagggcgtcgtcagcgggcccgcgaactggtgttac
gaggacgacgacatttcggcggtacaaaagaagatggagaacgcgcagatccgccgcgtg
ccggtggtcgaccggcagaagcggctggtcggcatcgtcgcgctgggtgatctggcgacc
gccgcggacggcgcgatgtcgtcgacgctcggcgccgtgtcggcgccgtcgcgcccggac
cggtga

DBGET integrated database retrieval system