KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6586Help
Entry
Bcen2424_6586     CDS       T00415                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:808956..809963
Genome map
AA seq 335 aa AA seqDB search
MSSDEVSESRRKWVQGTTAGLVASVALPTLAQTGGGAPDAGDTAPRDPRTLYPHAPFPQQ
QQPWPGLAGRMTPRPDHGERSYRGSGRLDGRKALITGGDSGIGRAVAIACAREGADVAIV
YLPDEEPDAREVVDQIRGAGRKAVPLPVDIRSEGACNGLVERAVAALGGLDILVNNAGRQ
QSHESILDISTEQFDWTLRTNLYAMFWITRAAIPHMPPGSAIVNTTSVNAYDPSANLLDY
AMTKAAIANFTKGLAKQMIKRGIRVNGVAPGPFWTPLQVSGGQTTHNVETFGEQVPMGRP
GQPAEIASIYVELLSSRSSYVTGQIYGASGGAGQP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgacgaagtttccgaatcgcgccgcaaatgggtgcaaggcacgacggccgga
ctggtcgccagcgtcgccctgccgacgctcgcgcagacgggcggcggcgcgcccgacgcc
ggcgatacggcgccgcgcgatccgcgcacgctttatccgcatgcgccgtttccgcaacag
cagcagccctggccgggcctcgcgggccgcatgacgccgcgccccgatcacggcgagcgc
agttatcgcggcagcggccggctcgacggccgcaaggcgctgatcaccggcggcgactcg
ggcatcggccgcgcggtggcgattgcctgtgcacgagaaggcgcggacgtcgcgatcgtc
tatctgcccgacgaggagcccgatgcgcgcgaagtcgtggaccagatccgcggcgcggga
cgcaaggcggtgccgctgccggtcgacattcgcagtgaaggcgcgtgcaacggcctcgtc
gaacgggcggtcgccgcgctcggcgggctcgacattctggtgaacaacgcgggccgccag
cagagccacgaatcgatcctcgacatcagcaccgagcagttcgactggacgctgcgcacc
aacctttacgcgatgttctggatcacgcgggccgccattccacacatgccgcccggttcg
gcgatcgtcaacacgacgtcggtcaatgcgtacgacccgtcggcgaacctgctggactac
gcgatgacgaaagcggcgatcgcgaatttcacgaaggggctcgcgaagcagatgatcaag
cgcggcatccgcgtcaacggcgtcgcgccggggccgttctggacgccgttgcaggtcagc
ggcgggcagacgacgcacaacgtggagacgttcggcgaacaggtgccgatggggcggccg
gggcaaccggccgagatcgcgtcgatctacgtcgagctgctttcgtcgcgttcgagctac
gtgaccgggcagatctatggcgcgtcgggtggggcggggcagccttag

DBGET integrated database retrieval system