KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6589Help
Entry
Bcen2424_6589     CDS       T00415                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02049  NitT/TauT family transport system ATP-binding protein
Organism
bch  Burkholderia cenocepacia HI2424
Module
bch_M00188  NitT/TauT family transport system
Brite
Transporters [BR:bch02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    Bcen2424_6589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA AAA_22 AAA_29 AAA_28 AAA_16 ABC_ATPase RsgA_GTPase AAA_23 Mg_chelatase AAA_5 NACHT DUF815 Rad17 AAA_33 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ABK13319
JGI: Bcen24246589
Position
3:812255..813253
Genome map
AA seq 332 aa AA seqDB search
MVGPHGAQPYVDAFPARDSTVNATSPRTWLPPYTARGSASPAASAASEAGAAGRPAAQAA
QAGAHSERLLAIDAVSLEYRSGARIVRATHQVSFDVYGSDRFVLLGPSGCGKSTLLKAVA
GFIEPVSGSITLDGQPVRGPGPDRIVVFQEFDQLPPWKTVVENVAFPLRAAAKLSRAEAR
ERALHYLDKVGLSTFADAYPHTLSGGMKQRVAIARALAMQPRVLLMDEPFAALDALTRRK
MQEELLRLWDEFRFTLLFVTHSIEEALVVGNRILLLSPHPGRVRAELNSHEHSLENVDTG
DFRDNVARIHHLLFDTDAPHAPHAATTEDAAS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggttggtccgcacggcgcccagccgtatgttgatgcttttcccgcaagagattcgacc
gtgaacgccacttctccccgaacctggttgccgccgtatacggcacgcggcagcgcatcg
ccggccgcgtccgccgcatccgaggccggtgccgccgggcggccggcggcgcaggccgcg
caggccggcgcgcacagcgaacgcctgctcgccatcgacgcggtcagcctcgaataccgc
agcggcgcgcggatcgttcgcgcgacacatcaggtgagcttcgacgtgtacggcagcgac
cgcttcgtgctgctcggcccgtcggggtgcgggaagtcgacgctgctgaaggcggtcgcc
ggcttcatcgagcccgtctcgggttcgatcacgctcgacggtcagcccgtgcgcgggccg
gggcccgaccgcatcgtcgtgttccaggagttcgaccagttgccgccgtggaagacagtc
gtcgagaacgtcgcgtttccgttgcgcgccgccgcgaagctgtcgcgcgccgaagcacgc
gaacgtgcgctgcactatctcgacaaggtcggcctgagcacgtttgccgacgcctatccg
catacgctgtcgggcggcatgaagcagcgtgtcgcgattgcgcgggcgctggcaatgcag
ccgcgcgtgctgctgatggacgaaccgttcgcggcgctcgacgcgctcacgcgccgcaag
atgcaggaggaactgctgcggctgtgggacgaattccgcttcacgctgctgttcgtcacg
cactcgatcgaggaggcgctggtggtcggcaaccggattctgctgctgtcgccgcatccg
ggccgcgtgcgcgcggagctcaacagtcacgagcattcgctggagaacgtcgataccggc
gacttccgcgacaacgtcgcgcgaatccaccacctgctgttcgacaccgacgcaccgcat
gcaccgcacgcagcgacgacggaggacgccgcatcatga

DBGET integrated database retrieval system