KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6592Help
Entry
Bcen2424_6592     CDS       T00415                                 

Definition
(GenBank) luciferase family protein
  KO
K17228  
dimethylsulfone monooxygenase [EC:1.14.14.35]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bcen2424_6592
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.35  dimethylsulfone monooxygenase
     Bcen2424_6592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:complement(815568..816755)
Genome map
AA seq 395 aa AA seqDB search
MSDSTLAAPLAPTPFVDVRSPAEFPGSPVSRTLAQPLMLGLFLPIQAGGWSASTLPRSTD
WTFDYNADLVARAEALGFDLVFALSQWLPKGGYGGVFDGQALDSFMTLAALTARTERIIL
VATSHVLYGPWHPLHFAKFTATLDHISRGRWGINVVTGHRAIEHEMFGWNRIEHDRRYEM
AAEFLDAVQQLWAQPDNFSYTPELSSWRLGGAFVTPKPRYGRPLLINATGSDAGIAFAAR
YSDIVFVTSPAGPDAERAIDALPAHTARVKAAAAARGRTIRTLLNPLVICRETAAEARAY
RDAIVAHADEGSFHRFDSDAHAWRGGFEQRAQAAARAIGGNISITGSPEEVADIIVRLHR
AGIDGVQLSFYDFKPDLDFFGERVLPLLRKAGLRR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattccaccctcgccgccccgctcgcgccgacgccgttcgtcgacgttcgttcg
ccggccgagttccccggcagccccgtctcgcgcacactcgcgcagccgctgatgctcggg
ttgttcctgccgatccaggctggcggatggagcgcgtcgacgctgccgcgctcgaccgac
tggacgttcgactacaacgccgatctcgtagcccgcgccgaagcgctcggcttcgatctc
gtgttcgcgctgtcgcaatggttgccgaaaggcggctacggcggcgtgttcgacggccag
gcgctcgactcgttcatgacgctggccgcgctgacggcgcgcaccgagcggatcatcctc
gtcgcgacgagccacgtgctctacgggccgtggcatccactgcatttcgcgaagttcacc
gcgacgctcgaccacatttcgcgcggccgctggggcatcaacgtggtgaccggccaccgc
gcgatcgagcatgagatgttcggctggaaccggatcgaacacgaccggcgctacgagatg
gccgccgaattcctcgatgcggtccagcagttgtgggcgcaaccggataatttcagctac
acgcccgagctgtcgagctggcggctgggcggcgcattcgtcacgccgaagccgcgctac
ggtcgcccgctgctgatcaacgcgacgggttccgatgcgggcatcgcgttcgccgcgcgc
tattcggacatcgtgttcgtcacgagtccggctggcccggacgccgaacgcgcgatcgac
gcgctgcccgcgcatacggcccgcgtgaaggcggcggccgccgcgcgcggccgcacgatc
cgcaccttactcaatccgctcgtgatctgccgcgagacggcggccgaagcgcgcgcctac
cgtgacgcgatcgtcgcgcatgcggacgaaggcagcttccaccgcttcgacagcgacgcg
cacgcgtggcgcggcgggttcgagcagcgtgcgcaggccgccgcgcgcgcgatcggcggc
aatatctcgatcaccggctcgcccgaagaagtcgccgatatcatcgtgcggctgcaccgc
gcgggcatcgacggcgtccagttgagtttctacgatttcaagcccgacctggacttcttc
ggcgagcgcgtgctgccgctgctgcgcaaagccggcctgcggcgttaa

DBGET integrated database retrieval system