KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6603Help
Entry
Bcen2424_6603     CDS       T00415                                 

Definition
(GenBank) amidohydrolase
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3:828615..829886
Genome map
AA seq 423 aa AA seqDB search
MSKIVFTNVNIFDGSGADPYKGEVLIENDRIKSVSKGGDVMRPADAQIVDGRGKFVMPGM
TEAHTHFSWNDQPTLAAIQFMPPEEHILWCVRVAKRYLDMGFTSALGAAAAKPRLDVVLR
NAINAGEFPGPRYLAGSQEITTLGGLGDNTLPHLPYRELNFGEVVSGPEEVRRATRMFVK
YGVDHLKINLSGEYIAGIPAEASPFSEEEIAMLSAEAKRAGKRVAAHARSSESVKQCVRH
GFELVFHASFADEEALDMLEANKDRHIVAPGIGWLVSTLYHAEQWGITEAIATKMGYARE
LEIASETLTKMHKRGIRIAPGGDYGFAWMPHGTNSRDLEHFVKYIGMTPKEALLAATRLG
SDVMMHSEIGQIRDGYVADIVFVDGNPLDDLKVLQDPAKIVAVLQAGEFRKGGSGLQHQL
EQL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcgtatttacgaacgtcaacattttcgacgggagcggagcagatccctat
aaaggcgaagtcctcatcgaaaatgatcgaatcaagtctgtgtcgaaaggcggcgacgtc
atgcgccccgcagacgcgcagatcgtcgatggtcgaggcaagttcgtcatgcccggcatg
acggaagcacacacccacttctcgtggaacgaccagccgacgcttgcggctatccagttc
atgccgccggaggagcatattctctggtgtgtacgggtcgcaaagcgctatctggacatg
ggctttacgtcggcgctcggagccgcggcggccaagccgcgcctcgacgtcgtgttgcgc
aacgctatcaacgcgggcgaatttcccggcccgcgttatctcgcgggcagtcaggaaatc
acgacgttgggcggcttgggcgacaacacgcttccgcacctcccgtatcgtgagctcaac
ttcggggaggttgtcagcggtccggaagaggtccgccgcgcgactcgcatgtttgtgaag
tacggcgttgatcacctgaaaatcaacctttccggcgagtatatcgccggcattccggcc
gaagcatcgccgttctcggaagaagaaatcgcgatgttgagcgccgaagcgaaacgtgcc
ggcaaacgtgtagcagcccatgcccgttcgagcgagtcagtgaagcagtgtgtccgacac
ggctttgaactggtctttcacgcaagcttcgcggacgaggaagccctggacatgctggaa
gcgaacaaggacaggcatatcgtcgccccggggatcggctggctcgtaagtacgctttac
cacgcggagcagtggggtatcaccgaagcgatcgcaacgaagatgggctatgcacgtgaa
ctggagatagcttccgagacgctcaccaaaatgcacaagcgtggaattcgcatcgcgccg
ggaggcgattacgggttcgcgtggatgccgcatggcaccaactcccgcgacctcgaacat
ttcgtcaagtacatcggcatgacgccgaaagaggccttgctagccgcgacccgcctggga
agcgacgtcatgatgcactccgaaatcgggcaaatccgcgacggatacgtggccgacatc
gtgttcgtcgacggaaatccactggacgatctgaaggttctgcaagatccggccaagatc
gtcgcggtgctgcaagcaggcgagtttcgtaagggcgggtccgggcttcagcatcagctc
gagcaactgtaa

DBGET integrated database retrieval system