KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_118Help
Entry
BCHRO640_118      CDS       T02430                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
bchr00260  Glycine, serine and threonine metabolism
bchr00750  Vitamin B6 metabolism
bchr01100  Metabolic pathways
bchr01110  Biosynthesis of secondary metabolites
bchr01120  Microbial metabolism in diverse environments
bchr01230  Biosynthesis of amino acids
Module
bchr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCHRO640_118 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCHRO640_118 (thrC)
Enzymes [BR:bchr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCHRO640_118 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AGC03399
UniProt: L0MU80
Position
139572..140873
Genome map
AA seq 433 aa AA seqDB search
MKLYNINQPSEQVTFTQALLQGLGKNQGLFFPKDLPKFSIFEINSLLEMSFIERSTHILS
TYIGSELSKNSILTCVKNAFNFPVPLVCINNNVAILELFHGPTLAFKDFGSRLMAQMLNQ
TNHCSDKPMVILTATSGDTGAAVAHAFFNLSNIHVIILYPRGKISALQEKLFCTLGGNIS
TISVNGDFDSCQRLVKKAFDDSVLRQKLNLNSANSINIARLLAQICYYFEGVSQLPHQMR
NKLVIAVPSGNFGNLTAGLLAQSCGLPVKKFIAATNINDTVPRFLEFGYWEPRPTLSTFS
NAMDVSSPNNWSRIEELFRRENKSIKELEYGCVNDFLTEKTVQEIADLGYLSEPHTAVAY
RSLCDKLHSDEFGIFLGTAHPVKFKELVEDFLKKKIQLILPIVLKERMKLPVLSYNIPTC
FSSLRNLILSIMS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatataatattaatcaacctagtgaacaagtcacgtttactcaagctctctta
caaggattaggaaaaaatcaggggttatttttcccaaaagatcttccaaaattctctata
tttgaaataaattctctcttagaaatgagttttatagaacgtagtacgcatattttgtct
acatatattggctctgaattatcaaaaaatagtatattaacttgtgttaaaaatgctttt
aattttccagtcccattagtgtgtataaataataatgttgcaattttagaactttttcat
ggcccaactttggcttttaaagattttggaagccgattaatggcgcaaatgttaaatcag
actaaccattgttctgataaaccgatggttattctgactgctacttctggagatacaggt
gctgctgtagcccatgctttttttaatttaagcaatatacatgttataattctttaccct
agaggcaagattagtgcattacaagaaaaattattttgcactttaggaggcaatatttct
acaatatcagtaaatggagattttgattcatgtcaacgtttagttaagaaagcttttgat
gacagtgtactgcgacagaaattaaatttaaattctgcgaattccattaacattgcccga
ttattagctcaaatttgttactattttgaaggggtatcacaattaccgcatcaaatgcgt
aataaattagttattgcggttcctagcggtaattttggaaatttaacagcaggactatta
gctcaatcttgtggattaccagtaaagaagtttattgctgctactaatattaatgatact
gtgcctagatttttagagtttggttattgggaacctcgtcctactctttcaacgttttct
aatgctatggatgtaagctctccaaataattggtctagaatagaagaattgtttcgtcga
gaaaataaatccattaaagaattggaatatggttgtgttaatgattttctcaccgagaaa
acagtccaagaaattgcagatttaggatatctttccgaacctcataccgctgtagcatat
cgatcattgtgtgataaattacattctgatgaatttggtatatttcttggtactgctcac
cctgttaaatttaaagagttagtagaagattttttaaaaaaaaagatacaattaatatta
ccaattgtattaaaagaacgtatgaaattacctgttttatcgtataacatacctacatgt
ttctcttcattacgcaacctaattttaagcataatgtcttaa

DBGET integrated database retrieval system