KEGG   Candidatus Blochmannia chromaiodes: BCHRO640_118Help
Entry
BCHRO640_118      CDS       T02430                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bchr  Candidatus Blochmannia chromaiodes
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bchr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bchr00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bchr00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
139572..140873
Genome map
AA seq 433 aa AA seqDB search
MKLYNINQPSEQVTFTQALLQGLGKNQGLFFPKDLPKFSIFEINSLLEMSFIERSTHILS
TYIGSELSKNSILTCVKNAFNFPVPLVCINNNVAILELFHGPTLAFKDFGSRLMAQMLNQ
TNHCSDKPMVILTATSGDTGAAVAHAFFNLSNIHVIILYPRGKISALQEKLFCTLGGNIS
TISVNGDFDSCQRLVKKAFDDSVLRQKLNLNSANSINIARLLAQICYYFEGVSQLPHQMR
NKLVIAVPSGNFGNLTAGLLAQSCGLPVKKFIAATNINDTVPRFLEFGYWEPRPTLSTFS
NAMDVSSPNNWSRIEELFRRENKSIKELEYGCVNDFLTEKTVQEIADLGYLSEPHTAVAY
RSLCDKLHSDEFGIFLGTAHPVKFKELVEDFLKKKIQLILPIVLKERMKLPVLSYNIPTC
FSSLRNLILSIMS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatataatattaatcaacctagtgaacaagtcacgtttactcaagctctctta
caaggattaggaaaaaatcaggggttatttttcccaaaagatcttccaaaattctctata
tttgaaataaattctctcttagaaatgagttttatagaacgtagtacgcatattttgtct
acatatattggctctgaattatcaaaaaatagtatattaacttgtgttaaaaatgctttt
aattttccagtcccattagtgtgtataaataataatgttgcaattttagaactttttcat
ggcccaactttggcttttaaagattttggaagccgattaatggcgcaaatgttaaatcag
actaaccattgttctgataaaccgatggttattctgactgctacttctggagatacaggt
gctgctgtagcccatgctttttttaatttaagcaatatacatgttataattctttaccct
agaggcaagattagtgcattacaagaaaaattattttgcactttaggaggcaatatttct
acaatatcagtaaatggagattttgattcatgtcaacgtttagttaagaaagcttttgat
gacagtgtactgcgacagaaattaaatttaaattctgcgaattccattaacattgcccga
ttattagctcaaatttgttactattttgaaggggtatcacaattaccgcatcaaatgcgt
aataaattagttattgcggttcctagcggtaattttggaaatttaacagcaggactatta
gctcaatcttgtggattaccagtaaagaagtttattgctgctactaatattaatgatact
gtgcctagatttttagagtttggttattgggaacctcgtcctactctttcaacgttttct
aatgctatggatgtaagctctccaaataattggtctagaatagaagaattgtttcgtcga
gaaaataaatccattaaagaattggaatatggttgtgttaatgattttctcaccgagaaa
acagtccaagaaattgcagatttaggatatctttccgaacctcataccgctgtagcatat
cgatcattgtgtgataaattacattctgatgaatttggtatatttcttggtactgctcac
cctgttaaatttaaagagttagtagaagattttttaaaaaaaaagatacaattaatatta
ccaattgtattaaaagaacgtatgaaattacctgttttatcgtataacatacctacatgt
ttctcttcattacgcaacctaattttaagcataatgtcttaa

DBGET integrated database retrieval system