KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_118Help
Entry
BCHRO640_118      CDS       T02430                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCHRO640_118 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCHRO640_118 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCHRO640_118 (thrC)
Enzymes [BR:bchr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCHRO640_118 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
139572..140873
Genome map
AA seq 433 aa AA seqDB search
MKLYNINQPSEQVTFTQALLQGLGKNQGLFFPKDLPKFSIFEINSLLEMSFIERSTHILS
TYIGSELSKNSILTCVKNAFNFPVPLVCINNNVAILELFHGPTLAFKDFGSRLMAQMLNQ
TNHCSDKPMVILTATSGDTGAAVAHAFFNLSNIHVIILYPRGKISALQEKLFCTLGGNIS
TISVNGDFDSCQRLVKKAFDDSVLRQKLNLNSANSINIARLLAQICYYFEGVSQLPHQMR
NKLVIAVPSGNFGNLTAGLLAQSCGLPVKKFIAATNINDTVPRFLEFGYWEPRPTLSTFS
NAMDVSSPNNWSRIEELFRRENKSIKELEYGCVNDFLTEKTVQEIADLGYLSEPHTAVAY
RSLCDKLHSDEFGIFLGTAHPVKFKELVEDFLKKKIQLILPIVLKERMKLPVLSYNIPTC
FSSLRNLILSIMS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatataatattaatcaacctagtgaacaagtcacgtttactcaagctctctta
caaggattaggaaaaaatcaggggttatttttcccaaaagatcttccaaaattctctata
tttgaaataaattctctcttagaaatgagttttatagaacgtagtacgcatattttgtct
acatatattggctctgaattatcaaaaaatagtatattaacttgtgttaaaaatgctttt
aattttccagtcccattagtgtgtataaataataatgttgcaattttagaactttttcat
ggcccaactttggcttttaaagattttggaagccgattaatggcgcaaatgttaaatcag
actaaccattgttctgataaaccgatggttattctgactgctacttctggagatacaggt
gctgctgtagcccatgctttttttaatttaagcaatatacatgttataattctttaccct
agaggcaagattagtgcattacaagaaaaattattttgcactttaggaggcaatatttct
acaatatcagtaaatggagattttgattcatgtcaacgtttagttaagaaagcttttgat
gacagtgtactgcgacagaaattaaatttaaattctgcgaattccattaacattgcccga
ttattagctcaaatttgttactattttgaaggggtatcacaattaccgcatcaaatgcgt
aataaattagttattgcggttcctagcggtaattttggaaatttaacagcaggactatta
gctcaatcttgtggattaccagtaaagaagtttattgctgctactaatattaatgatact
gtgcctagatttttagagtttggttattgggaacctcgtcctactctttcaacgttttct
aatgctatggatgtaagctctccaaataattggtctagaatagaagaattgtttcgtcga
gaaaataaatccattaaagaattggaatatggttgtgttaatgattttctcaccgagaaa
acagtccaagaaattgcagatttaggatatctttccgaacctcataccgctgtagcatat
cgatcattgtgtgataaattacattctgatgaatttggtatatttcttggtactgctcac
cctgttaaatttaaagagttagtagaagattttttaaaaaaaaagatacaattaatatta
ccaattgtattaaaagaacgtatgaaattacctgttttatcgtataacatacctacatgt
ttctcttcattacgcaacctaattttaagcataatgtcttaa

DBGET integrated database retrieval system