KEGG   Candidatus Blochmannia chromaiodes: BCHRO640_142Help
Entry
BCHRO640_142      CDS       T02430                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bchr  Candidatus Blochmannia chromaiodes
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bchr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bchr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172374..173885
Genome map
AA seq 503 aa AA seqDB search
MCDSRNLYKLFIPYVFNNPTSPALTGMELDSRNIVLGNLFVAVKGSKTDGRLYIDYAIKK
GASAVLLESWSGITIFKKYSYHLNKIPVVHVNYLPRYLSDIAGSFYNHPSRFLDLIGVTG
TNGKTTITHLLARWVQLLGKKSAVMGTLGNGMLNNMCLSYNTTCSSIDAQKILSQFVKDK
ITFVAMEVSSHGLNQYRVDALYFKAAIFTNLSHDHLDYHGNFMQYSMSKWRLFDELCVEK
YIINADDPIGCRWLYYLPQAIAVTITRNLPFFWKGKWICAVKVNYHIHGTDITFDSSWGH
GVIHSQLLGEFNVSNLLLALGTLLVLGYPLSLLVHTSSQLQPVAGRMEVFRSHGYPTVIV
DYAHTPDALEKVLISIRRFYYWGQLWCVFGCGGDRDPSKRALMGYIVSRYADYIIITNDN
PRTEEPQSIINDITRGITHQKKIIKIIQNRCCAIQTAILKASLEDVILISGKGHEKYQII
GNNRIYHSDKDIVENFLKNDVVL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgattcacgtaatttatataaattatttattccatatgtttttaataatcctact
agtcctgcattgacggggatggaattggatagtcgtaacattgtattgggaaatttattt
gtagcagttaaaggttctaagactgatggaagattatatattgactatgcgatcaaaaag
ggagcttcggcagttttattagaatcttggagtggtataacaatatttaaaaaatatagt
tatcatttaaataaaatacctgtggtccatgttaactatttaccacggtatttgtccgat
atagcaggtagtttttataatcatccgtcacgttttttggatttaattggtgttactggc
actaatgggaaaactactataacgcatttgttagctcgttgggtccaattattaggaaaa
aaaagcgctgtgatgggtactttaggtaacggaatgttaaataatatgtgtttgtcttat
aatacaacatgctcttccattgatgctcaaaaaatattatctcagtttgttaaagataag
attacgtttgttgctatggaggtatcatcacatggattaaatcaatatcgcgtggatgct
ttatattttaaagcagctatatttactaatttaagccatgatcacttagattatcatggt
aactttatgcaatactctatgtctaagtggcggttatttgatgaattatgtgtagaaaaa
tatataattaatgctgatgaccccattggttgtcgatggttatattatttgcctcaagcg
atcgcagtgacaataacaaggaatttaccatttttttggaaaggtaaatggatatgtgcg
gttaaggtcaattatcatattcatggcacggatataacttttgattcaagttggggtcat
ggagtaattcatagtcaattattaggagaattcaacgttagcaatttgttattagcttta
ggtacgttattagtgttaggatatcctctgtcattattggtacacacgtcatctcaatta
caaccggtagctggtagaatggaagtatttcgttctcatggatatccgacggttatagtg
gattatgcgcatactccggatgcgttagaaaaagttctaatttcaattagacgattttat
tattggggtcaactatggtgtgtttttggttgcggaggagatagagatccaagtaaacgt
gctttaatgggttacattgtaagccggtatgctgattatataataattaccaatgataat
ccacgcacggaagaaccacaatcgattataaatgatattactcgtggcataacacaccaa
aaaaaaatcatcaaaattattcaaaatcgttgctgtgcgatacagactgctattttaaag
gcatctttagaagatgtaatattaatttctggaaaaggtcatgaaaaataccaaattatc
ggaaataatcgcatatatcattctgataaagacatagtagaaaattttttaaagaacgat
gttgttttatga

DBGET integrated database retrieval system