KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_158Help
Entry
BCHRO640_158      CDS       T02430                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
bchr00010  Glycolysis / Gluconeogenesis
bchr00020  Citrate cycle (TCA cycle)
bchr00620  Pyruvate metabolism
bchr01100  Metabolic pathways
bchr01110  Biosynthesis of secondary metabolites
bchr01120  Microbial metabolism in diverse environments
bchr01130  Biosynthesis of antibiotics
bchr01200  Carbon metabolism
Module
bchr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCHRO640_158 (aceF)
   00020 Citrate cycle (TCA cycle)
    BCHRO640_158 (aceF)
   00620 Pyruvate metabolism
    BCHRO640_158 (aceF)
Enzymes [BR:bchr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCHRO640_158 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT RnfC_N
Motif
Other DBs
NCBI-ProteinID: AGC03439
UniProt: L0MUC0
Position
complement(195468..196739)
Genome map
AA seq 423 aa AA seqDB search
MTIEINIPNIGEDELEVTEIMVKIGDNINANQPLIIIEGDKSSMEIPSSCSGIVTKIYVH
VGDKVHTGSLILLLDVRNHTHAFTINDKKNVVPSPYIVTNNDTKKGAICNDIHHDAAIHA
TPLVRHMARTFGIDLSKIKGSGRKGRILKEDIQNYIKDISMYYTSRTSSMQSDQLPPILS
WPKIDFSKFGDITTVMLSKIQKTSGANLQRNWIMLPHVTQFDEADITDLESFRKQQNIDI
EKKKINCKITLLVFVMKAVAKALEELPRFNSSLSQDGETLILKKYINIGIAVDTPKGLLV
PVLHDVNRKGIILLSQELEELAKKARTGNQLTPANMQGGSFTISNLGGIGGTAFTPIVNV
PEVAILGISKSFIKPVWTGKKFTPRLMLPLSLSYDHRVIDGADGARFMTLINKIIADTRL
LSM
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaaattaatataccaaatattggagaggatgaattagaagttacagaaata
atggtaaaaataggagataatatcaatgctaatcagccacttattataattgaaggtgat
aaatcatctatggaaataccatcttcctgttctggtattgttactaaaatttatgtccat
gttggagataaagtacatacaggatctttgattttactacttgatgtgcgaaatcatact
catgcttttactattaacgataaaaaaaatgttgttccttctccttatattgtaacaaac
aatgatacaaaaaaaggagcgatatgtaacgatatacaccatgatgccgcgatacatgct
acaccattagtgcgtcatatggctcgtacatttggaatagatttgtcaaaaataaaaggt
agtggccgtaagggacgtattttaaaagaagatattcaaaattatataaaagatatctca
atgtattatacaagccgtacatcatccatgcaatctgatcaattaccgcccatattatct
tggccgaagatagacttcagtaaatttggcgatattacaaccgtaatgttaagcaaaata
caaaaaacttctggtgcaaatttacaaagaaattggattatgcttccgcatgtaacgcaa
tttgatgaagctgatattaccgatttagaaagttttagaaaacaacaaaacattgatatt
gaaaagaaaaaaataaattgcaaaattacacttttagtttttgttatgaaagcagttgca
aaagcattagaagagttgccacgattcaatagttctttatctcaagacggagaaacacta
attttaaaaaaatatattaatattggcatagcagtggatactcctaaaggtttattagtg
cctgttctccatgatgtaaacaggaaaggtattattttattatcacaagagttagaagag
cttgcaaagaaagctcgtactgggaatcaattgactcctgctaatatgcaaggaggaagt
tttactatatccaatttggggggtataggaggtacagcttttactccaattgttaatgtt
ccagaagtagctattttaggcatttctaaatcttttataaaaccagtgtggaccggaaaa
aaatttactccgcgtttaatgctacctttgtcattatcatatgatcatcgtgttattgat
ggagctgatggtgctcgatttatgacgcttattaataaaataattgctgacacaagacta
ttatctatgtaa

DBGET integrated database retrieval system