KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_158Help
Entry
BCHRO640_158      CDS       T02430                                 

Gene name
aceF
Definition
Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCHRO640_158 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCHRO640_158 (aceF)
   00020 Citrate cycle (TCA cycle)
    BCHRO640_158 (aceF)
   00620 Pyruvate metabolism
    BCHRO640_158 (aceF)
Enzymes [BR:bchr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCHRO640_158 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(195468..196739)
Genome map
AA seq 423 aa AA seqDB search
MTIEINIPNIGEDELEVTEIMVKIGDNINANQPLIIIEGDKSSMEIPSSCSGIVTKIYVH
VGDKVHTGSLILLLDVRNHTHAFTINDKKNVVPSPYIVTNNDTKKGAICNDIHHDAAIHA
TPLVRHMARTFGIDLSKIKGSGRKGRILKEDIQNYIKDISMYYTSRTSSMQSDQLPPILS
WPKIDFSKFGDITTVMLSKIQKTSGANLQRNWIMLPHVTQFDEADITDLESFRKQQNIDI
EKKKINCKITLLVFVMKAVAKALEELPRFNSSLSQDGETLILKKYINIGIAVDTPKGLLV
PVLHDVNRKGIILLSQELEELAKKARTGNQLTPANMQGGSFTISNLGGIGGTAFTPIVNV
PEVAILGISKSFIKPVWTGKKFTPRLMLPLSLSYDHRVIDGADGARFMTLINKIIADTRL
LSM
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaaattaatataccaaatattggagaggatgaattagaagttacagaaata
atggtaaaaataggagataatatcaatgctaatcagccacttattataattgaaggtgat
aaatcatctatggaaataccatcttcctgttctggtattgttactaaaatttatgtccat
gttggagataaagtacatacaggatctttgattttactacttgatgtgcgaaatcatact
catgcttttactattaacgataaaaaaaatgttgttccttctccttatattgtaacaaac
aatgatacaaaaaaaggagcgatatgtaacgatatacaccatgatgccgcgatacatgct
acaccattagtgcgtcatatggctcgtacatttggaatagatttgtcaaaaataaaaggt
agtggccgtaagggacgtattttaaaagaagatattcaaaattatataaaagatatctca
atgtattatacaagccgtacatcatccatgcaatctgatcaattaccgcccatattatct
tggccgaagatagacttcagtaaatttggcgatattacaaccgtaatgttaagcaaaata
caaaaaacttctggtgcaaatttacaaagaaattggattatgcttccgcatgtaacgcaa
tttgatgaagctgatattaccgatttagaaagttttagaaaacaacaaaacattgatatt
gaaaagaaaaaaataaattgcaaaattacacttttagtttttgttatgaaagcagttgca
aaagcattagaagagttgccacgattcaatagttctttatctcaagacggagaaacacta
attttaaaaaaatatattaatattggcatagcagtggatactcctaaaggtttattagtg
cctgttctccatgatgtaaacaggaaaggtattattttattatcacaagagttagaagag
cttgcaaagaaagctcgtactgggaatcaattgactcctgctaatatgcaaggaggaagt
tttactatatccaatttggggggtataggaggtacagcttttactccaattgttaatgtt
ccagaagtagctattttaggcatttctaaatcttttataaaaccagtgtggaccggaaaa
aaatttactccgcgtttaatgctacctttgtcattatcatatgatcatcgtgttattgat
ggagctgatggtgctcgatttatgacgcttattaataaaataattgctgacacaagacta
ttatctatgtaa

DBGET integrated database retrieval system