KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_267Help
Entry
BCHRO640_267      CDS       T02430                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BCHRO640_267 (speB)
Enzymes [BR:bchr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BCHRO640_267 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295450..296370
Genome map
AA seq 306 aa AA seqDB search
MNTLNYKNDSSLFSNSFGFLRFPLEFDPYNSNSDWVITGVPFDLATSGRSGSRFGPTAIR
QASINLAWEHFRWPWNVNIRKNLHIIDCGDLIYKSGDIQDFTSSLQNHAENLLMSGKKML
SFGGDHYITLPILRAYAKFFGKLAIIHFDAHADYYDNDSKYDHGVVILHALNEKLIDPVH
SIQIGIRTEYKKCFGFTVLDAEYINDTNIDVIINKITSIAQSFPVYLTFDIDCLDPAIAP
GTGTPVIGGLTSYRVLKLIRGFQHLNIIGIDLVEVAPAYDCAQITALAAATIGLEMLYTQ
VKSKKN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatactttgaattataaaaatgatagctccctattttcaaattcctttggattttta
cgatttccattagaattcgatccttataatagtaatagtgattgggtaattactggagtt
ccttttgatttggctacgtctggtcgctcaggaagtagattcggaccgaccgctattaga
caggcatctattaatttagcctgggaacattttcgttggccttggaacgtgaatatacgc
aagaatttgcacataattgactgcggagatttaatatataaatctggagacatacaagat
ttcaccagttctctacaaaaccatgctgaaaatttactaatgtctggaaaaaaaatgtta
tcatttggaggtgatcattatatcacattacctatattacgtgcgtatgcgaaatttttt
ggaaaattagcaataatacattttgacgcacatgcagattattatgataacgatagtaaa
tatgatcacggtgttgtaatattacatgctcttaatgaaaaattaatagatcctgtacat
tcaatacaaattggtattcgtaccgaatacaaaaaatgtttcggatttacagtgctagat
gcagagtatattaatgatactaacattgatgttatcatcaataaaataacatcaatcgct
caatcctttccagtatatttaactttcgatattgattgtttggatccagctatagcacct
ggtactgggactccagtaattggaggattaacaagttaccgtgtattaaaattaatacga
ggttttcaacatttaaatattataggtattgatttagtagaggtagcaccagcttacgat
tgtgcacaaattactgctttagcagcagctacaatagggttggaaatgctttatactcaa
gtgaaatcaaagaagaattaa

DBGET integrated database retrieval system