KEGG   Candidatus Blochmannia chromaiodes: BCHRO640_267Help
Entry
BCHRO640_267      CDS       T02430                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bchr  Candidatus Blochmannia chromaiodes
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bchr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295450..296370
Genome map
AA seq 306 aa AA seqDB search
MNTLNYKNDSSLFSNSFGFLRFPLEFDPYNSNSDWVITGVPFDLATSGRSGSRFGPTAIR
QASINLAWEHFRWPWNVNIRKNLHIIDCGDLIYKSGDIQDFTSSLQNHAENLLMSGKKML
SFGGDHYITLPILRAYAKFFGKLAIIHFDAHADYYDNDSKYDHGVVILHALNEKLIDPVH
SIQIGIRTEYKKCFGFTVLDAEYINDTNIDVIINKITSIAQSFPVYLTFDIDCLDPAIAP
GTGTPVIGGLTSYRVLKLIRGFQHLNIIGIDLVEVAPAYDCAQITALAAATIGLEMLYTQ
VKSKKN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatactttgaattataaaaatgatagctccctattttcaaattcctttggattttta
cgatttccattagaattcgatccttataatagtaatagtgattgggtaattactggagtt
ccttttgatttggctacgtctggtcgctcaggaagtagattcggaccgaccgctattaga
caggcatctattaatttagcctgggaacattttcgttggccttggaacgtgaatatacgc
aagaatttgcacataattgactgcggagatttaatatataaatctggagacatacaagat
ttcaccagttctctacaaaaccatgctgaaaatttactaatgtctggaaaaaaaatgtta
tcatttggaggtgatcattatatcacattacctatattacgtgcgtatgcgaaatttttt
ggaaaattagcaataatacattttgacgcacatgcagattattatgataacgatagtaaa
tatgatcacggtgttgtaatattacatgctcttaatgaaaaattaatagatcctgtacat
tcaatacaaattggtattcgtaccgaatacaaaaaatgtttcggatttacagtgctagat
gcagagtatattaatgatactaacattgatgttatcatcaataaaataacatcaatcgct
caatcctttccagtatatttaactttcgatattgattgtttggatccagctatagcacct
ggtactgggactccagtaattggaggattaacaagttaccgtgtattaaaattaatacga
ggttttcaacatttaaatattataggtattgatttagtagaggtagcaccagcttacgat
tgtgcacaaattactgctttagcagcagctacaatagggttggaaatgctttatactcaa
gtgaaatcaaagaagaattaa

DBGET integrated database retrieval system