KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_282Help
Entry
BCHRO640_282      CDS       T02430                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCHRO640_282 (recD)
Enzymes [BR:bchr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCHRO640_282 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(316619..318526)
Genome map
AA seq 635 aa AA seqDB search
MKDVINNILKLGLWHSLDVQFADVLALPIYDGNRHNNIKEALILASATLSSKVRDGHVCL
PLQCLTPDKLFQGNYPELTYAIYRKLGKLSISSWQELLFSCPAVSDGSRVTPLILENKRL
YLHQMWQDECIVAQFFNHKYPSNIFQKEKIIYALNQLFPITYTEVDWHKIATAIGITHHR
VLISGGPGTGKTSIIAKIVATLLLCSKNNDLNIQITAPTGKAAALLTESFRTTIHNIPQL
EKLLLCNLPEKATTLHSLLRTRLYKENIQYNCFNLTHLDLLIIDEASMVSLSMLAQIILI
LSPQTKVIFLGDQYQLCSVEPGSVFKDVCQFSNFYYSRKRYQELIDLTGYILPIISPSKS
SMHYNYNSIIDGTCILKKNYRFSESSGINKLSGAINSGDYNHALSLLKSSIYKDLYYIYF
VDKKSYITMILNCAMAYSNYLQKLKHTKVLTENILKIFNHYRILCALRDGPFGVIRLNYY
IEQILNEKGLIQLNNSRNYLGRPIIILRNKPSLELYNGDVGVLLLNDQNKLSAYFILPRG
GIKVIQINQLPEHETCFAMTIHKAQGSEFQHTAIVLPNKYIPLLTRELLYTAVTRARQCL
YLYATDHVIIRSVNSITQRYSGLYEKIKNHIIPIV
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgttattaacaatattttaaaattagggttgtggcattcactagatgtacaa
tttgccgatgtattagctcttcccatttatgatgggaatcgacataataatataaaggaa
gcattaattttagctagcgcaactctaagctctaaagttagggatggccatgtttgttta
cctttgcagtgtcttactcccgataaattatttcaaggaaattatcctgaattaacgtat
gcgatatatagaaaattagggaaattatcgatatcctcctggcaggaattattgttttct
tgtcccgcagttagtgatggatcacgggtcactccattaatattggaaaataaacgttta
tatttacatcaaatgtggcaagatgaatgcatagtcgcgcaattttttaatcataaatat
ccatcaaatatttttcaaaaagaaaaaataatttatgcattaaatcaattatttcctata
acttatacagaagttgattggcataaaatagctactgctattggcataacacatcacaga
gtgctaatttctggaggacctggaactggaaaaacatctattatagcgaagatagtagcg
acattattgttatgtagcaagaataatgatctaaatattcaaataaccgctcccacagga
aaagcagcagctcttttaactgaatctttcagaacaacaatacacaatattccacaatta
gaaaagcttctcttatgtaacttaccagaaaaagctactactctacatagtttgcttaga
acacgattatataaagaaaatattcaatataactgctttaatctcacgcacttagatctt
ttaattattgatgaagcttctatggttagtctatctatgttagctcagataattttgata
ctttctcctcaaacgaaagttatttttttgggtgatcaatatcaattatgttcagtagaa
cctggatccgtatttaaagatgtgtgtcaattttctaatttttattattctcgtaaacgt
tatcaagaacttatagatcttacaggttacatattgcctattatatctccttctaaatca
tctatgcattacaattataatagtattattgatggcacatgcatactaaagaaaaattat
cgatttagtgaaagttcaggaattaataaattatctggtgctataaattcaggagattat
aatcatgcgttatcattgttaaaatcaagcatatataaggatttatattatatttatttt
gtagacaaaaaaagctatataactatgattcttaattgtgcaatggcatattctaactat
ttacaaaaattgaaacacactaaagtcctgacagaaaatattttaaagattttcaatcat
tatcgaatattatgtgcattacgtgatggcccgttcggagtaataagacttaattattat
attgaacaaatattaaatgagaaaggattaattcaattaaataattctaggaattattta
ggtagacctattattatattacgtaataaaccatcattagaattatataatggagatgtt
ggtgtattgttattaaatgatcaaaataaattgtctgcatattttattttgccacgagga
ggtataaaagttatacaaataaatcaattaccggagcatgaaacttgtttcgctatgact
atacataaagcgcaaggatctgaatttcaacataccgcaatagtattgcccaataaatat
ataccattattgacacgagaattactctatactgctgtcactagagctcgtcaatgcctt
tatttgtacgcgacagatcatgtaataatacgcagtgttaattcgatcacacaacgttat
agtggattatatgaaaaaataaaaaatcatataatccccatagtttaa

DBGET integrated database retrieval system