KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_347Help
Entry
BCHRO640_347      CDS       T02430                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCHRO640_347 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCHRO640_347 (sdhD)
   00650 Butanoate metabolism
    BCHRO640_347 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BCHRO640_347 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399535..399882
Genome map
AA seq 115 aa AA seqDB search
MVSIKSILKYHGVYEWLLVRISAVWMLLYIVYISIFIISANNLSYDKWYDFFSKNTTKIF
SIMGLLSALSHAWIGMRHILEDYITLPVLRQLGAWITGSILFAYLFFGMIIIWSV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtatccatcaaatcaatcttgaaatatcacggagtgtacgaatggttgctagtacga
atttcagccgtctggatgttgctatacatcgtgtatatttctattttcattatttcagct
aacaacttatcttatgataaatggtacgatttttttagcaaaaacaccactaaaatattt
agtatcatgggtttattatctgccctaagtcatgcttggattggtatgcgccacatacta
gaagactatataacattacctgtgctaaggcagttgggagcgtggataaccggttctata
ttgttcgcatacttattttttgggatgattattatttggagtgtatag

  All links  
No link information was found.   
DBGET integrated database retrieval system