KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_347Help
Entry
BCHRO640_347      CDS       T02430                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
bchr00020  Citrate cycle (TCA cycle)
bchr00190  Oxidative phosphorylation
bchr00650  Butanoate metabolism
bchr01100  Metabolic pathways
bchr01110  Biosynthesis of secondary metabolites
bchr01120  Microbial metabolism in diverse environments
bchr01130  Biosynthesis of antibiotics
bchr01200  Carbon metabolism
Module
bchr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bchr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCHRO640_347 (sdhD)
   00650 Butanoate metabolism
    BCHRO640_347 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BCHRO640_347 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AGC03606
UniProt: L0MWU5
Position
399535..399882
Genome map
AA seq 115 aa AA seqDB search
MVSIKSILKYHGVYEWLLVRISAVWMLLYIVYISIFIISANNLSYDKWYDFFSKNTTKIF
SIMGLLSALSHAWIGMRHILEDYITLPVLRQLGAWITGSILFAYLFFGMIIIWSV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtatccatcaaatcaatcttgaaatatcacggagtgtacgaatggttgctagtacga
atttcagccgtctggatgttgctatacatcgtgtatatttctattttcattatttcagct
aacaacttatcttatgataaatggtacgatttttttagcaaaaacaccactaaaatattt
agtatcatgggtttattatctgccctaagtcatgcttggattggtatgcgccacatacta
gaagactatataacattacctgtgctaaggcagttgggagcgtggataaccggttctata
ttgttcgcatacttattttttgggatgattattatttggagtgtatag

DBGET integrated database retrieval system