KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_351Help
Entry
BCHRO640_351      CDS       T02430                                 

Gene name
sucB
Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCHRO640_351 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCHRO640_351 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BCHRO640_351 (sucB)
Enzymes [BR:bchr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCHRO640_351 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405517..406761
Genome map
AA seq 414 aa AA seqDB search
MSSIDIVVPNLPESVADATVAVWHKKSGDTVKQDDILLEIETDKIMLEIPAPNTGILESI
SEQEGSTVVSGQILGRLNIDHIVSKKDTKKIFQDQKSITSVASQEHILTRDNKNHNILTP
SIRKLMTEHNLQLTNIQGSGIKGRLTRQDIESHIHSEKKLHYTDQQNNENVAHHHIQNTK
NDRKETRIVMNRLRKKISERLLAVTKTTAMLTTFNEVNMQPIIKLRKKYGELFEKRYGIT
LGIMSFYVKAVLEGLRHFPEINASIDGEEIVYYHYFDISIAVSTVRGLITPVLRDIDTLS
MSDIEKNIKSLAEKGRDGKLTIEELSGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAI
KDRPIAQDGQIVILPMMYLALSYDHRLIDGKDSVRFLVYIRELLEDPTRLFLEI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtattgacattgtggttccgaatttaccagaatcggttgcagacgctactgtt
gctgtttggcataaaaaatcaggagatacagttaaacaagatgatattttactggaaata
gaaacagacaaaattatgttagaaattcctgctccaaacacaggaattttagaatcaatt
tcagaacaagagggatcaacagtagtatccggccaaattttaggccgtctaaatattgat
catatcgtttccaaaaaagatacaaaaaaaatatttcaagatcaaaaatctattacatca
gtagcgtctcaagaacatattcttactcgagataacaaaaatcataacattttaactcca
tctattcgtaaattaatgaccgagcataatttacagctaacaaatattcaaggcagtgga
ataaaaggacgtctaactcgtcaagatatagagtcacatattcattccgaaaaaaaatta
cattatactgatcaacaaaataatgaaaatgtagcgcatcatcacatacaaaatacaaaa
aacgatcgcaaagaaacacgtattgtaatgaatcgattacgaaaaaaaatctcagaacgc
ctattagctgttactaaaactacagctatgttaactacttttaatgaagtaaacatgcaa
cccatcataaaactgcgaaaaaaatatggagaattgtttgaaaaacgttatggaattaca
ttaggaatcatgtctttttatgtaaaagcagttttagaaggattgagacattttcctgaa
attaatgcatccattgatggagaagaaattgtatattatcattattttgatataagtatt
gcagtatctacagtacgtggtttaattactccagtgttacgagatatcgatacattaagc
atgtctgacatagaaaaaaatataaaatctttagctgaaaaaggaagagacggtaaacta
acaattgaagaattaagcggaggtaattttaccattactaacggtggagtttttggatca
ttaatgtctactcctatcattaatcctccacaaagcgcaattcttggtatgcatgcaata
aaggaccgacccatagctcaagatgggcagatagtaatattacctatgatgtatttagca
ttatcatatgatcatagattaatagatggaaaagattcggtaagatttctagtatacatc
agagagttgttagaagacccaacacgcttgtttttagaaatataa

DBGET integrated database retrieval system