KEGG   Candidatus Blochmannia chromaiodes: BCHRO640_351Help
Entry
BCHRO640_351      CDS       T02430                                 

Gene name
sucB
Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bchr  Candidatus Blochmannia chromaiodes
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bchr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bchr00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bchr00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405517..406761
Genome map
AA seq 414 aa AA seqDB search
MSSIDIVVPNLPESVADATVAVWHKKSGDTVKQDDILLEIETDKIMLEIPAPNTGILESI
SEQEGSTVVSGQILGRLNIDHIVSKKDTKKIFQDQKSITSVASQEHILTRDNKNHNILTP
SIRKLMTEHNLQLTNIQGSGIKGRLTRQDIESHIHSEKKLHYTDQQNNENVAHHHIQNTK
NDRKETRIVMNRLRKKISERLLAVTKTTAMLTTFNEVNMQPIIKLRKKYGELFEKRYGIT
LGIMSFYVKAVLEGLRHFPEINASIDGEEIVYYHYFDISIAVSTVRGLITPVLRDIDTLS
MSDIEKNIKSLAEKGRDGKLTIEELSGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAI
KDRPIAQDGQIVILPMMYLALSYDHRLIDGKDSVRFLVYIRELLEDPTRLFLEI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtattgacattgtggttccgaatttaccagaatcggttgcagacgctactgtt
gctgtttggcataaaaaatcaggagatacagttaaacaagatgatattttactggaaata
gaaacagacaaaattatgttagaaattcctgctccaaacacaggaattttagaatcaatt
tcagaacaagagggatcaacagtagtatccggccaaattttaggccgtctaaatattgat
catatcgtttccaaaaaagatacaaaaaaaatatttcaagatcaaaaatctattacatca
gtagcgtctcaagaacatattcttactcgagataacaaaaatcataacattttaactcca
tctattcgtaaattaatgaccgagcataatttacagctaacaaatattcaaggcagtgga
ataaaaggacgtctaactcgtcaagatatagagtcacatattcattccgaaaaaaaatta
cattatactgatcaacaaaataatgaaaatgtagcgcatcatcacatacaaaatacaaaa
aacgatcgcaaagaaacacgtattgtaatgaatcgattacgaaaaaaaatctcagaacgc
ctattagctgttactaaaactacagctatgttaactacttttaatgaagtaaacatgcaa
cccatcataaaactgcgaaaaaaatatggagaattgtttgaaaaacgttatggaattaca
ttaggaatcatgtctttttatgtaaaagcagttttagaaggattgagacattttcctgaa
attaatgcatccattgatggagaagaaattgtatattatcattattttgatataagtatt
gcagtatctacagtacgtggtttaattactccagtgttacgagatatcgatacattaagc
atgtctgacatagaaaaaaatataaaatctttagctgaaaaaggaagagacggtaaacta
acaattgaagaattaagcggaggtaattttaccattactaacggtggagtttttggatca
ttaatgtctactcctatcattaatcctccacaaagcgcaattcttggtatgcatgcaata
aaggaccgacccatagctcaagatgggcagatagtaatattacctatgatgtatttagca
ttatcatatgatcatagattaatagatggaaaagattcggtaagatttctagtatacatc
agagagttgttagaagacccaacacgcttgtttttagaaatataa

DBGET integrated database retrieval system